Conserved Protein Domain Family
gspJ

?
TIGR01711: gspJ 
type II secretion system protein J
This model represents GspJ, one of two proteins highly conserved at their N-termini and described by pfam02501 but easily separable phylogenetically. The other is GspI. Both GspI and GspJ are proteins of the type II secretion pathway, or main terminal branch of the general secretion pathway. This pathway carries proteins across the outer membrane. Note that proteins of type II secretion are cryptic in E. coli K-12 - present but not yet demonstrated to act on any target.
Statistics
?
PSSM-Id: 130772
View PSSM: TIGR01711
Aligned: 3 rows
Threshold Bit Score: 282.573
Threshold Setting Gi: 139794
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45776  14 AGFTLIEVLVAIAIFASLSVGAYQVLNQVQRSNEISAERTARLAELQRAMVIMDADFRQMALRQFRTDGEApSEQILQWK 93  Vibrio cholerae O1 bi...
P31739   6 GGFTLLEMLVAIAIFASLSMGAYQVLQGVLTSDEVAKKKEARLSELQLAFTLMERDITQMVPRSGRIDGEN-NKVLLAAS 84  Aeromonas hydrophila
Q00517   5 RGFTLLELLIAIAIFALLALATYRMFDSVMQTDQATRVQEQRMRELVRAMGALERDLTQAVERPVRDELG-----DNRGA 79  Pseudomonas aeruginos...
P45776  94 ESLLDSDQHGLLFVRLGWHNPQQQFPRGEVAKVGYRLFENRLERVWWRYPDTPAGQQGLISPLLTGVEDWAVQFYLQ-GE 172 Vibrio cholerae O1 bi...
P31739  85 RFGQQSDDWGMAFIRGGWLNPDGMLPRSGLQRVGWRLKDHKLERLSYLYPDPVIGTEPRIQPMLDRVTALRLYFYDK-GA 163 Aeromonas hydrophila
Q00517  80 FLSEGENDQIVEFTRGGWRNPLG-QARSRLQRVRWSLSGETLERRYWLVLDRAQDSKPRVQQVLDGVTALSWRFLDKeHN 158 Pseudomonas aeruginos...
P45776 173 WSKEWVPTN--------ALPEAVKVTLRLKDYGEIERIYLTG 206 Vibrio cholerae O1 biovar El Tor str. N16961
P31739 164 WKEEWTQRN--------VLPYGLAVELDLEDYGTLRRQFLIG 197 Aeromonas hydrophila
Q00517 159 WQGHWPTDEgseeerleSLPLAVEMTLEHRHYGKLVRVWRLL 200 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap