Conserved Protein Domain Family
typeII_sec_gspG

?
TIGR01710: typeII_sec_gspG 
type II secretion system protein G
This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130771
View PSSM: TIGR01710
Aligned: 6 rows
Threshold Bit Score: 179.544
Threshold Setting Gi: 499182692
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA56982       9 RGFTLMEIMVVIFIIGLLIAVVAPSVLGNQDKAMRQKVMADLATLEQALDMYRLDNLRFPSNEQGLAALVKKPEQAPLPR 88  Pseudomonas putida
CAC89662       7 KGFTLLEIMVVIVILGLLASLTIPSLMSNKNRADQQKAVSDISALENALDMYRLDNGDYPTEQQGIAALVTKPNVPPLPQ 86  Yersinia pestis...
Q00514         7 SGFTLIEIMVVVVILGILAALVVPQVMSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPK 86  Pseudomonas aer...
AAC17881      50 RGFTLLELLVVLVVLGLLAGIVAPKYFSQLGRSEAKVARAQIEGLSKALDLYRLEVGHYPNSEQGLQALVVAPSGETR-- 127 Pseudomonas put...
WP_003110089   7 QGFTLLEMIVVLVIIGMLMGLVGPRLFNQADKAKAQTADTQVKMLKGALLTMRLDIGRLPTEEEGLALLNTPPSDERLGA 86  Pseudomonas
WP_010880232   3 RGFTLIEVLVVLIILGLLAALIVPKLTGRVDEARIESTKLQLKAVKNALEQFKLDNGFYPTTEQGLKALVEKPTTPPEPK 82  Aquifex aeolicus
CAA56982      89 AWRSdGYVR-R-LPQDPWGTPYQYRMPGEH-GRVDVYSLGADGVPggeGQDADLGNWA 143 Pseudomonas putida
CAC89662      87 RYPSdGYIR-R-LPTDPWGNSYQMNNPGKH-GQIDIFSIGPDRLP---ETEDDIGNWI 138 Yersinia pestis CO92
Q00514        87 NWNKdGYLK-K-LPVDPWGNPYQYLAPGTK-GPFDLYSLGADGKEggsDNDADIGNWD 141 Pseudomonas aeruginosa PAO1
AAC17881     128 -WTG-PYLQ-KaVPQDPWGRPYIYRQPGENgGEYDLLSMGKDGQPggdGENAEITSWQ 182 Pseudomonas putida GB-1
WP_003110089  87 FWHG-PYLEgG-VPLDPWNRPYLYSDRPSAeQPFTLYSQGADGQPggkGLDADVGYAP 142 Pseudomonas
WP_010880232  83 NWKQ--YME-K-VPKDAWGNDFIYVSPAGN-KPYELKSVGPDGIEg---TEDDISVWD 132 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap