Conserved Protein Domain Family
typeII_sec_gspH

?
TIGR01708: typeII_sec_gspH 
type II secretion system protein H
This model represents GspH, protein H of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130769
View PSSM: TIGR01708
Aligned: 4 rows
Threshold Bit Score: 160.038
Threshold Setting Gi: 499216812
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P31735         4 HRQSGFTLLEVLLVAMLMGLVATAVTLSMGGaRGDRELDKQARRFMATLQQAQEYSVMDGRL--VGLRIEDHGWQFMQRA 81  Aeromonas hydro...
AAG04067       4 PRQSGFTLIELMVVLVIVGIATAAISLSARP-DPTGLLRQDAARLARLLEIAQGEARVRGTP--ILWQPSAKGYRFSPQA 80  Pseudomonas aer...
CAA56983       2 RREQGFSLIELLVVLAIAGLMTSLAVAWLD--SGKTNVDQALQRLAAETRTQAALARHAGQLr--GLRWTGQRPEFVRRE 77  Pseudomonas putida
WP_010914352  12 HATAGFTLVEMLVVLAIMALVAAIAAPGLVShYRTKSLETVAGEITMRLRLSRTSAIATARPkqVLVDLGSRVIRFGERD 91  Mesorhizobium loti
P31735        82 AKDRKwqaltgdkilgqvqlpdtmllAIELEGFSWRTESDEKTERGRDEkertpqVLIFPGGELSPFVLTLTQQDEDVry 161 Aeromonas hydro...
AAG04067      81 YRGKTdaf----------------aaDTELRARDWQAAPLRVSVRPPRP------VLLDAEWIGAPLRITLSDGQHSV-- 136 Pseudomonas aer...
CAA56983      78 GDAWV---------------------VETVALGDWPKGLR-PDWPASAQp----hLLFTPQGWAQPGSVRWHWAKGSQ-- 129 Pseudomonas putida
WP_010914352  92 SLALP----------------------DDVKMTVITGQETVVADRQTVLt-------FLPDGRASGMDMALQRKGRTA-- 140 Mesorhizobium loti
P31735       162 lrTVKADEFGRLRLL 176 Aeromonas hydrophila
AAG04067     137 --TVLREANGHVRVR 149 Pseudomonas aeruginosa PAO1
CAA56983     130 --QWAWRRDGKLQLA 142 Pseudomonas putida
WP_010914352 141 --RIAVNWLTGLPTW 153 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap