Conserved Protein Domain Family
MTA/SAH-nuc-hyp

?
TIGR01705: MTA/SAH-nuc-hyp 
5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, putative
This model represents the enzyme 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase which acts on its two substrates at the same active site. This clade of sequences is sufficiently distinct from the characterized proteins, which form the seed of TIGR01704 as to cast some doubt on the accuracy of annotations based on sequence similarity alone. This enzyme is involved in the recycling of the components of S-adenosylmethionine after it has donated one of its two non-ribose sulfur ligands to an acceptor. In the case of 5'-methylthioadenosine this represents the first step of the methionine salvage pathway in bacteria. This enzyme is widely distributed in bacteria.
Statistics
?
PSSM-Id: 130766
View PSSM: TIGR01705
Aligned: 2 rows
Threshold Bit Score: 405.135
Threshold Setting Gi: 499273398
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010914444   1 MMANITRIGGKDVLFVMAAQAEYGPHLQKLFTPLMTGVGPVEAAVRVGAELSWLKSQQALPDLVVSLGSAGSRTLEQTEI 80  Mesorhizobium loti
WP_010970791   1 MSYRLSHVADKSVLFVMAASAEYGPHLQARIAPLMTGVGPVEAAISVTAILAGLDAADNLPDLVVSLGSAGSRTLQQTGI 80  Agrobacterium f...
WP_010914444  81 YQAVSVSYRDIDASPLGFERGATPFLDLPVTAPLPFRIPEIKQATLSTGGAIITGAAYDAIAADMVDMETFACLRACQLF 160 Mesorhizobium loti
WP_010970791  81 YQAVSVSYRDMDASAFGFEKGRTPFLDLPAEVALPLRIPDIAEARLSTGGNVVSGEAYGLIDADMVEMETFAVLRACQRF 160 Agrobacterium f...
WP_010914444 161 DVPLIGLRGISDGAADLRHVGDWTEYLHVIDEKLADAVMRLEQAIGSGLLGI 212 Mesorhizobium loti
WP_010970791 161 GVPLISLRGISDGKADVNHVDDWTAYLDIIDEKLANAVDRLCRAIEDGVIAL 212 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap