Conserved Protein Domain Family
hybrid_clust

?
TIGR01703: hybrid_clust 
hydroxylamine reductase
This model represents a family of proteins containing an unusual 4Fe-2S-2O hydrid cluster. Earlier reports had proposed a 6Fe-6S prismane cluster. This subfamily is heterogeneous with respect to the presence or absence of a region of about 100 amino acids not far from the N-terminus of the protein. Members have been described as monomeric. The general function is unknown, although members from E. coli and several other species have hydroxylamine reductase activity. Members are found in various bacteria, in Archaea, and in several parasitic eukaryotes: Giardia intestinalis, Trichomonas vaginalis, and Entamoeba histolytica. [Cellular processes, Detoxification, Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130764
View PSSM: TIGR01703
Aligned: 7 rows
Threshold Bit Score: 710.813
Threshold Setting Gi: 499169839
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC90189       1 MFCVQCEQTIRtpaGNGCSyAQGMCGKTAETSDLQDLLVAVLQGLSAWALQARELGiID-SQIDSFAPRAFFSTLTNVNF 79  Yersinia pestis...
AAK80696       3 MFCYQCQEAAG---CKGCT-VRGVCGKTEDLAKKQDLLIYTLKVVSLYNVEARKLN-LVnKEIDNYIVDSLFATITNANF 77  Clostridium ace...
AAL66298       1 MFCAQCEETNN---NTGCT-KKGVCGKQASTANIEDEMVQIVKEISIALGDGAVS-----IEMGELLNKTLFMTITNANF 71  Trichomonas vag...
AAL66296       4 MFCNQCEQTAK---GTGCT-VCGVCTKEPIVSNTMDVLIYALRMNALVALKAKKNGiEVdNEYHVLTCSALFSTLTNVNF 79  Entamoeba histo...
O27502         1 MFCYQCSQTVR---GRACT-IRGVCGKEP--------------------------------------------------- 25  Methanothermoba...
P96095         2 MFCYQCEQTTRspaGIGCTsEPGTCGKDEATAVLQDILTHLMKGIASMRAG-RAMGvAD-RRTDDFIFYGLFTTLTNVNF 79  Acidithiobacill...
WP_010868115   1 MLCNQCSMSLS---G-GCT-VRGVCGKDP--------------------------------------------------- 24  Pyrococcus abyssi
CAC90189      80 DSDRIVEYAKDAILLRHSLAVRCRLLDSTitvdhplae---lqlvaddipSLLQQSqqFALNNDKADVGDDIHGLRMLCL 156 Yersinia pestis...
AAK80696      78 DENIFTERIEKGIKYKEELKKQISAAGGN---------------------VNLNEK--TEAVGVLSTENEDIRSLRELLT 134 Clostridium ace...
AAL66298      72 DDIALKRQLDYCKEIKSKLTKKN------------------------------IT----APLGVNSHSNPDVVSLREMIL 117 Trichomonas vag...
AAL66296      80 SEKDISQIVEQVFIQRKKLIEKLPKNELNgved-------------vedvAHYIEThlSDKRPNKWIDNQDIQSLMQTII 146 Entamoeba histo...
O27502        26 ----------------------------------------------------------------------TVARLQDNLL 35  Methanothermoba...
P96095        80 TATRFVHLIQEASKRRERIKLLYEEAAREqgktpeilsgpalfqpadsleQLLRQApsVAINADVEHLGSDVIGARALIL 159 Acidithiobacill...
WP_010868115  25 ----------------------------------------------------------------------DLNSLQDALI 34  Pyrococcus abyssi
CAC90189     157 YGLKGAAAYMEHAHVLGQSDEQIYAEYHAYMAWLGTQP-RDVDTLLNNAMGIGKMNFNVMAILDQGETQAYGDPQPTSVN 235 Yersinia pestis...
AAK80696     135 YGIKGMAAYLKHARNLSYEDSNIQGFMSKALAATLDDT-LGADELVALALECGKYGVDAMALLDKANTETYGNPEITKVN 213 Clostridium ace...
AAL66298     118 YGIKGIAAYIDHAAMIGFHDPEIYAWQVKTLAKLSKE--EDINNLIALTLETGKYCVKGMELLDKANTSRYGKPEMTKVN 195 Trichomonas vag...
AAL66296     147 FGLKGICAYVCHAHLLKKDNVQIFEFIQVALAAGYDGKeRTLEDWIHLTLEVGKWSLETMKLLDEAN-NTLGHPEPTEVL 225 Entamoeba histo...
O27502        36 FAIKGISAYLYHARELGYTDEEVDAFLERGFYSTLTNVnFDAGEFIDLALEAGEMNIRTMKLLKKAHIDTYGEPEPTEVR 115 Methanothermoba...
P96095       160 YGMKGVALIAQHARVLGYQSDEVMPQAEEILDYLASNP-TDLDEMLEESLEVGRLNLKVMELLDVANTDSFGAQEITSVR 238 Acidithiobacill...
WP_010868115  35 YGIKGTAAYYYHALEMGYDNPEIGHFLAEALYSTLTNVnFDKNRFIDLILENGRIHLEAMKLLDKAYTETFGLPKPVEVP 114 Pyrococcus abyssi
CAC90189     236 VRPVAGKAILISGHDLKDLHMLLEQTQG----TGINIYTHGEMLPAHGYPELKRYPHLVGNYGSGWQNQQTEFAKFPGPI 311 Yersinia pestis...
AAK80696     214 IGTRNNPGILISGHDLKDIEELLKQTEG----TGVDVYTHSEMLPANYYPAFKKYSHFVGNYGNAWWKQNEEFESFNGPI 289 Clostridium ace...
AAL66298     196 IGVGTRPGILVSGHDLRDLEDLLEQTKD----SGVDVYTHGEMLPARGYPFFKRYPHLRGNYGGPWFRQDREFGPFNGPI 271 Trichomonas vag...
AAL66296     226 IGHKAGKCILVTGHDLHDLELLLKQTEG----KGVNVYTHGEMLPAHGYPLLKKYKHLIGHFGTAWQNQQREFPTFPGAI 301 Entamoeba histo...
O27502       116 VGALEGPAIIATGHSLRALEELLKQTEG----TGINVYTHSELLPAHGYPGLRKYPHLAGQLGGPWFDQKDTFSRYTAAI 191 Methanothermoba...
P96095       239 ISPIQGKAILVSGHDLHDLKQILEQTKD----QGINVYTHGEMLPANAYPLLKAYPHLAGNLGGAWQDQQREFADFPGPI 314 Acidithiobacill...
WP_010868115 115 TGTTEGHGIVVTGHSYKALYELLNQIREmgleEEIKVYTHSEMLPAHSYPEIRKFKSLYGNWGGSWVYQRKEFAEFPGVI 194 Pyrococcus abyssi
CAC90189     312 LMTSNCIIDPNvgNYGDRIWTRSIVGWPGVNHLDGD-------NFAPVIEQALGMAgFPYSELEHLITVGFGRQTLLNA- 383 Yersinia pestis...
AAK80696     290 LMTTNCIVPPKa-SYIDRMYTTGVTGYPGVKHIENGep----kDFSAIIEHAKKCA-PPTEIEKGEIIGGFAHNQVIAL- 362 Clostridium ace...
AAL66298     272 FMTTNCIVPVRk-EYKDRIFTTGAVGWPELKHIPDRkdvngqkDFSEIVALAKTCP-PPKELEKGQVTVGLAHDQVLAV- 348 Trichomonas vag...
AAL66296     302 LFTTNCLMKPLp-SYKDRVFTTNEVGFNGLVHIGNDk------DFTPVIQKALEMEgFTDDLKEDTVTTGFSHHAILEEk 374 Entamoeba histo...
O27502       192 LGTSNCVLLPRd-DYRDRMFTCGVAALPGVEHLEGY-------DFSPLIDKALELPpLSEE-DATTLTTGFGLSTILSL- 261 Methanothermoba...
P96095       315 VMTSNCIIEPGr-SYKNRIFTLGPVGWPGVRHIDNG-------DFTPVIQAAKALPgFTADAKEQRITIGFGHHTLLGV- 385 Acidithiobacill...
WP_010868115 195 IGTSNCVQQPTk-AYQDRIFTVGIAGLEGVPHLEDY-------DFEPAIKRALETPkMGKR-EGEKIVTGFHHTYILAM- 264 Pyrococcus abyssi
CAC90189     384 -ADTVIDLVASKKLRHVFLVGGCDGSRTERSYFTDFARSVPQDCIIMTLACGKYRFNKLDFGTLEGLPRLLDVGQCNDAY 462 Yersinia pestis...
AAK80696     363 -ADKVVEAVKSGAIKRFYVMAGCDGRAKTRNYYTDFAKALPKDAVILTAGCAKYKYNKLDLGDIGGIPRVLDAGQCNDSY 441 Clostridium ace...
AAL66298     349 -ADKIVEGVKNGQIKKFVCMGGCDGRHKERDYYTKVAKALPKDTLILTAGCAKYRYNKLDLGDINGIPRVIDAGQCNDSY 427 Trichomonas vag...
AAL66296     375 tANKLVSLIKEGKIKNIFVVGGCDGAKAGRNYYTELVQKIPKDSIILTCACGKFRFFREKLGDIEGIPRLLDLGQCNDSY 454 Entamoeba histo...
O27502       262 -ADKIRELVEDGKIRRFFLVGGCDSPLPRAKYYTEFVRKLPEDTVVLTLACGKYRFNSMDLGDIEGVPRLIDLGQCNDAI 340 Methanothermoba...
P96095       386 -ADKIVDAVKHGDIRHFFLVGGCDGVSPARNYFTEVADNAPADSVVMTLGCGKYRFNKHEFGDIGGIPRLLDIGQCNDAH 464 Acidithiobacill...
WP_010868115 265 -KDKLIELINEGKIRHIFVIGGCDVPNPKMSYYEKLTELVPRDAIILSAACGKFRYNRRDYGSIEGIPRFMDFGQCNNVY 343 Pyrococcus abyssi
CAC90189     463 AAIMLAVKLSEKLGCT-VNDLPLSLVLSWFEQKAIVILLTLLSLGVKNIYTGPTAPGFLTDNLMAILYEKFGMQP--ITT 539 Yersinia pestis...
AAK80696     442 SLVVIALKLKEVFGLNdINELPIAYNIAWYEQKAVIVLLALLHLGVKNIHLGPTLPAFLSPNVAKVLVDNFGIGG--ITN 519 Clostridium ace...
AAL66298     428 SLAIIALKLKKVFGLDdVNKLPLAFDIAWYEQKAACILLALLFLGFKNIRVGPTLPGFLSPNVANVLVKNFGIKG--IGS 505 Trichomonas vag...
AAL66296     455 SAIVVALKLAEIFKCG-VNELPLHLILSWYEQKAVAVLLALLYLGIKNIRIGPSAPAFLTPGVFKYLHDNLNLMM--TTT 531 Entamoeba histo...
O27502       341 VAVELVEALSNLFQMD-INELPLSIILSWMEQKAAAILWSLLSLDLKGMYIGPILPGWANEDIVKFLVDNYDLTP--IGD 417 Methanothermoba...
P96095       465 SAIRVAGALAEAFNCG-VNDLPLSIMLSWFEQKATAIHLSLLALGIKGIKLGPTLPAYLTPTLVQKLQSRFDLDLdlIGE 543 Acidithiobacill...
WP_010868115 344 SIIEIALALAKELDMD-INSLPVSIVLSWMEQKAIGILYTLLYLGVKGIYIGPKSPEFLTPRVFEILRKQFDLRL--ISE 420 Pyrococcus abyssi
CAC90189     540 VEQDMQAIL 548 Yersinia pestis CO92
AAK80696     520 VEDDIKMFE 528 Clostridium acetobutylicum ATCC 824
AAL66298     506 IEDDLKDIL 514 Trichomonas vaginalis
AAL66296     532 PDNDLANL- 539 Entamoeba histolytica
O27502       418 PEEDIRKIL 426 Methanothermobacter thermautotrophicus str. Delta H
P96095       544 AQADLQAAL 552 Acidithiobacillus ferrooxidans
WP_010868115 421 PEKDLREML 429 Pyrococcus abyssi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap