1MJG,1JQK


Conserved Protein Domain Family
CO_DH_cata

?
TIGR01702: CO_DH_cata 
Click on image for an interactive view with Cn3D
carbon-monoxide dehydrogenase, catalytic subunit
This model represents the carbon-monoxide dehydrogenase catalytic subunit. This protein is related to prismane (also called hybrid cluster protein), a complex whose activity is not yet fully described; the two share similar sets of ligands to unusual metal-containing clusters.
Statistics
?
PSSM-Id: 130763
View PSSM: TIGR01702
Aligned: 8 rows
Threshold Bit Score: 930.701
Threshold Setting Gi: 399279
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MJG_A        28 TVDPAVLEMLVKSKDD-KVITAFDRFVAQQPQ-CKIGYEGICCRFCMAGPCRIKaTDGPGSRGICGASAWTIVARNVGLM 105 Moorella thermo...
P31896        10 SSDACATEMLNLAEAN-SIETAWHRYEKQQPQ-CGFGSAGLCCRICLKGPCRIDpFGEGPKYGVCGADRDTIVARHLVRM 87  Rhodospirillum ...
AAK78101       9 VCDDADKTLRDFICGLnNVETSEHRVESQKNK-CKFGKDGVCCKLCANGPCR---ITPKSPRGICGADADTIVARNFLRA 84  Clostridium ace...
AAK80452      14 SYHDSVEEMVKKIRED-GMSNVFDRYALQEKIrCKFCLEGLSCQLCSNGPCRIS-EKTGQEKGVCGIGPDAMAMRNFLLK 91  Clostridium ace...
WP_010870233   6 AAIPEVKEMVEKAKLK-GIETPHTRFPNQFPK-CPYGLKGVYCILCANGPCRI---TEKTPYGVCGATADVIVARNLCRA 80  Methanocaldococ...
P27989        28 TVDPAVLEMLVKSKDD-KVITAFDRFVAQQPQ-CKIGYEGICCRFCMAGPCRIKaTDGPGSRGICGASAWTIVARNVGLM 105 Moorella thermo...
WP_010879343   8 SEHESINMMYERVSKE-GVTNIVDRFNAQEKGrCPFCEKGLSCQLCSMGPCRIS---KDKPTGACGIDAAGMVVRNFTHK 83  Archaeoglobus f...
1JQK_A        10 SSDACATEMLNLAEAN-SIETAWHRYEKQQPQ-CGFGSAGLCCRICLKGPCRIDpFGEGPKYGVCGADRDTIVARHLVRM 87  Rhodospirillum ...
1MJG_A       106 ILTGAAAHCEHGNHIAHALVEMAEGKAPdYSVKDEAKLKEVCRRVGIEVEGKSVlELAQEVGEKALEDFRRLkGEGEATW 185 Moorella thermo...
P31896        88 IAAGTAAHSEHGRHIALAMQHISQGELHdYSIRDEAKLYAIAKTLGVATEGRGLlAIVGDLAAITLGDFQNQdYDKPCAW 167 Rhodospirillum ...
AAK78101      85 VAAGTACYVHVVETTARNLKALGENKKP---IKGMYTLNKLANMFKIDE-KDDH-KKAVMIADRVLSDLYKP-RFEKAEL 158 Clostridium ace...
AAK80452      92 NIMGAGTYSHHAYEAYRTLKATAEGRTP-FKITDENKLKWMCEKLGIDTAQSIN-DMAFELAVILEDQQRIG-VEDQNVM 168 Clostridium ace...
WP_010870233  81 VAAGTSCYVHCAENAARALLSAGKGEGS-YEIRNEKKLKFLAKKLGFDANKDAK-QLAVEVAEFILDDMYKP-RWEKSEL 157 Methanocaldococ...
P27989       106 ILTGAAAHCEHGNHIAHALVEMAEGKAPdYSVKDEAKLKEVCRRVGIEVEGKSVlELAQEVGEKALEDFRRLkGEGEATW 185 Moorella thermo...
WP_010879343  84 NMLGTEAYTYHAIEAAKTLKATAEGKTI-YEIKDVEKLKWFAKLLGIEGEDV-N-ELAAKVADFVISDLS---SLEKSRL 157 Archaeoglobus f...
1JQK_A        88 IAAGTAAHSEHGRHIALAMQHISQGELHdYSIRDEAKLYAIAKTLGVATEGRGLlAIVGDLAAITLGDFQNQdYDKPCAW 167 Rhodospirillum ...
1MJG_A       186 LMTTINEGRKEKFRTHNVVPFGIHASISELVNQAHMGMDNDPVNLVFSAIRVALAD-YTGEHIATDFSDILFGTPQPVVS 264 Moorella thermo...
P31896       168 LAASLTPRRVKRLGDLGLLPHNIDASVAQTMSRTHVGCDADPTNLILGGLRVAMAD-LDGSMLATELSDALFGTPQPVVS 246 Rhodospirillum ...
AAK78101     159 VSEIAYAPRLKKWQELNILPGGAKSEVFDAIVKTSTNLNSDPVDMTVNCLTLGISTgLYGLTLTNLLNDVILGEPVIRQA 238 Clostridium ace...
AAK80452     169 VEAFAPKKRIEAWKKLGIYPAGTVHEEQNCVASCLTNVDGSHISLAMKALRLGIATiYNTQIGLEMVQDILFGTPTPHEV 248 Clostridium ace...
WP_010870233 158 VPKLCPEKRLEVFEKLDILPGGAKGEIVDALTKTSTNLNSNPMDLLVHCLRLGLHAgFTGLLMTCWLNDILFGSPKITVV 237 Methanocaldococ...
P27989       186 LMTTINEGRKEKFRTHNVVPFGIHASISELVNQAHMGMDNDPVNLVFSAIRVALAD-YTGEHIATDFSDILFGTPQPVVS 264 Moorella thermo...
WP_010879343 158 VEIFAPEKRKELWEKLGIFPSGVFQELLTMGSSAMTNVDSNYVSLAKKSMSMSIATcMAAQIALETIQDILFGTPMPHES 237 Archaeoglobus f...
1JQK_A       168 LAASLTPRRVKRLGDLGLLPHNIDASVAQTMSRTHVGCDADPTNLILGGLRVAMAD-LDGSMLATELSDALFGTPQPVVS 246 Rhodospirillum ...
1MJG_A       265 EANMGVLDPDQVNFVLHGHNPLLSEIIVQAAR--EMEGEAKAAG-AKGI-NLVGICCTGNEVLMRQG------IPLVTSF 334 Moorella thermo...
P31896       247 AANLGVMKRGAVNIAVNGHNPMLSDIICDVAA--DLRDEAIAAGaAEGI-NIIGICCTGHEVMMRHG------VPLATNY 317 Rhodospirillum ...
AAK78101     239 NVGFKVVDPDYINIMITGHQHSVIEHLQERLIdeDITKKAQAIG-AKGF-KLVGCTCVGQDLQLRGEhykevfSGHAGNN 316 Clostridium ace...
AAK80452     249 NMDLGIMDPEYVNIVFNGHQPWIGAATILKAKtpEIQDMAKQAG-AKGL-RVVGSIETGQELLQRFPvde-vfVGHMGNW 325 Clostridium ace...
WP_010870233 238 ENGFSSVKPNNVNIMITGHQHALIQPLCEAAMeeDLIKMAKEAG-ADEI-KIIGATCNGQDMETRIAhlpesfVGYIANN 315 Methanocaldococ...
P27989       265 EANMGVLDPDQVNFVLHGHNPLLSEIIVQAAR--EMEGEAKAAG-AKGI-NLVGICCTGNEVLMRQG------IPLVTSF 334 Moorella thermo...
WP_010879343 238 HSDLGILDPEYVNIAVNGHEPFVGIALIKLAEreEIQEKARKAG-AKGL-RIIGFIETGQEILQRVDsp--vfAGIVGNW 313 Archaeoglobus f...
1JQK_A       247 AANLGVMKRGAVNIAVNGHNPMLSDIICDVAA--DLRDEAIAAG-AAEGiNIIGICCTGHEVMMRHG------VPLATNY 317 Rhodospirillum ...
1MJG_A       335 ASQELAICTGAIDAMCVDVQCIMPSISAVAECYHTRIITTADNAKIPGAYH-IDYQTATAIESAKTAIRMAIEAFKERKe 413 Moorella thermo...
P31896       318 LSQELPILTGALEAMVVDVQCIMPSLPRIAECFHTQIITTDKHNKISGATH-VPFDEHKAVETAKTIIRMAIAAFGRRD- 395 Rhodospirillum ...
AAK78101     317 FTSEALIATGGIDLIMSEFNCTLPGIEPIAEEFEVKMICVDDVAKKKNADF-IKYSYEERENITDSIIEEALKSYENRRk 395 Clostridium ace...
AAK80452     326 LAIEPLLATGTVDIFAMEENCSPPAIDMYAEKYQVTLAAVSTIIDLPGVNYkFPYDPAQADETAQRLIELGIENFKKRKe 405 Clostridium ace...
WP_010870233 316 FTTEPLVATGLIDAVVSEFNCTFHGLKFVAEKTKTKLICIDDMAYVEGAEY-IPWEPENAKEKAREIIKKAIEAFKERKg 394 Methanocaldococ...
P27989       335 ASQELAICTGAIDAMCVDVQCIMPSISAVAECYHTRIITTADNAKIPGAYH-IDYQTATAIESAKTAIRMAIEAFKERKe 413 Moorella thermo...
WP_010879343 314 IVQEYALATGCVDVFAADMNCTLPSLPEY-QRYGVKIVPVSRLVRLKGIDEgLDYEPEKAEEIAMKLIDMAIENFKQRDk 392 Archaeoglobus f...
1JQK_A       318 LSQELPILTGALEAMVVDVQCIMPSLPRIAECFHTQIITTDKHNKISGATH-VPFDEHKAVETAKTIIRMAIAAFGRRD- 395 Rhodospirillum ...
1MJG_A       414 sNRPVYIPQIK--NRVVAGWSLEALTKLLATQN-----AqnpirVLNQAILDGELAGVALICGCNNLKGF-QDNSHLTVM 485 Moorella thermo...
P31896       396 -PNRVAIPAFK--QKSIVGFSAEAVVAALAKVN-----AddplkPLVDNVVNGNIQGIVLFVGCNTTKVQ-QDSAYVDLA 466 Rhodospirillum ...
AAK78101     396 -DVTINIPKDHgyDDVVTGVSEKSLKDFLGGTW-----K-----PLVDLIASGKIKGVAGVVGCSNLTAKgHDVFTVELT 464 Clostridium ace...
AAK80452     406 -RQIKPHVPQKi-QKAIAGFSTEAVLGALGNKL-----D-----PLVDVIAKGQIKGVVALANCSTLRNGpQDWVTINLT 473 Clostridium ace...
WP_010870233 395 -MQKDYY-DEK--VKSVVGVGEESLVEFLGGSV-----K-----PLIELIASGKIKGVVGVVGCSNLASGgHDNIIVTLT 460 Methanocaldococ...
P27989       414 sNRPVYIPQIK--NRVVAGWSLEALTKLLATQN-----AqnpirVLNQAILDGELAGVALICGCNNLKGF-QDNSHLTVM 485 Moorella thermo...
WP_010879343 393 -SKAVKV-EQK--KKIVVGFSPEAILKALNGDL-----N-----VLLDAIKKGDIKGVVALVSCTTLKNGpHDSSTVTIA 458 Archaeoglobus f...
1JQK_A       396 -PNRVAIPAFK--QKSIVGFSAEAVVAALAKVNaddplK-----PLVDNVVNGNIQGIVLFVGCNTTKVQ-QDSAYVDLA 466 Rhodospirillum ...
1MJG_A       486 KELLKNNVFVVATGCSAQAAGKLGLLDPANVETYCGDGLKGFLKRLGeganieigLPPVFHMGSCVDNSRAVDLLMAMAN 565 Moorella thermo...
P31896       467 KSLAKRNVLVLATGCAAGAFAKAGLMTSEATTQYAGEGLKGVLSAIGtaaglggpLPLVMHMGSCVDNSRAVALATALAN 546 Rhodospirillum ...
AAK78101     465 KELIKRNIIVLSAGCSSGGLENVGLMSPSAA-DLAGDSLKEVCKSLG--------IPPVLNFGPCLAIGRLEIVATELAE 535 Clostridium ace...
AAK80452     474 KELIKRDILVVSGGCGNHALEVAGLCTLDAANNIAGNGLKAVCNALK--------IPPVLSFGTCTDTGRISMLVTALAE 545 Clostridium ace...
WP_010870233 461 KELIKRDILVLAGGCVNSPLKHAGLFDPASA-ELAGENLKEVCKSLG--------IPPVLNFGACLSIARIEQVAVAIAE 531 Methanocaldococ...
P27989       486 KELLKNNVFVVATGCSAQAAGKLGLLDPANVETYCGDGLKGFLKRLGeganieigLPPVFHMGSCVDNSRAVDLLMAMAN 565 Moorella thermo...
WP_010879343 459 KELIKRDILVLSMGCGNAALQVAGLTSMEAV-ELAGEKLKAVCKALN--------IPPVLSFGTCTDTGRAAYLVRLIAD 529 Archaeoglobus f...
1JQK_A       467 KSLAKRNVLVLATGCAAGAFAKAGLMTSEATTQYAGEGLKGVLSAIGtaaglggpLPLVMHMGSCVDNSRAVALATALAN 546 Rhodospirillum ...
1MJG_A       566 DLGVDTPKVPFVASAPEAMSGKAAAIGTWWVSLGVPTHVGTMPPVEGSDLIYSILTQIASDVYGGYFIFEMDPQVAARKI 645 Moorella thermo...
P31896       547 KLGVDLSDLPLVASAPECMSEKALAIGSWAVTIGLPTHVGSVPPVIGSQIVTKLVTETAKDLVGGYFIVDTDPKSAGDKL 626 Rhodospirillum ...
AAK78101     536 YLGIDIPQLPLVLSAPQWLEEQALADGAFGLSLGLPLHLAISPFIDGSAVVSKLLKEDLTDITGGKLIIEEDVIKAADKL 615 Clostridium ace...
AAK80452     546 HLNVDVPQLPIAVTAPEWMEQKATIDGIFALAYGAYTHLSPTPFMTGARQLVDLLTNKAEDVTGGKIALGDDPMKVANDI 625 Clostridium ace...
WP_010870233 532 ELGVDIPDLPVAASAPQWLEEQALADATYAVDMGFTVHVSPVPFVTGSELVTKVLTEAVEGLTGGKLIPEPNPYKAADLL 611 Methanocaldococ...
P27989       566 DLGVDTPKVPFVASAPEAMSGKAAAIGTWWVSLGVPTHVGTMPPVEGSDLIYSILTQIASDVYGGYFIFEMDPQVAARKI 645 Moorella thermo...
WP_010879343 530 ALGVDVPQLPVAVTAPEYMEQKATIDAVFAVAYGLTTHVSPVPPITGSEDAVKLFTEDVEKLTGGKVVVEEDPLKAAELL 609 Archaeoglobus f...
1JQK_A       547 KLGVDLSDLPLVASAPECMSEKALAIGSWAVTIGLPTHVGSVPPVIGSQIVTKLVTETAKDLVGGYFIVDTDPKSAGDKL 626 Rhodospirillum ...
1MJG_A       646 LDALEYRTWKLGV 658 Moorella thermoacetica
P31896       627 YAAIQERRAGLGL 639 Rhodospirillum rubrum
AAK78101     616 EREIIDRREKLGL 628 Clostridium acetobutylicum ATCC 824
AAK80452     626 EDHIMRKRKELGL 638 Clostridium acetobutylicum ATCC 824
WP_010870233 612 EQTIMEKRKKLGI 624 Methanocaldococcus jannaschii
P27989       646 LDALEYRTWKLGV 658 Moorella thermoacetica
WP_010879343 610 EKVIEEKRKALGI 622 Archaeoglobus fulgidus
1JQK_A       627 YAAIQERRAGLGL 639 Rhodospirillum rubrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap