1YQQ


Conserved Protein Domain Family
XAPA

?
TIGR01699: XAPA 
Click on image for an interactive view with Cn3D
xanthosine phosphorylase
This model represents a small clade of purine nucleotide phosphorylases found in certain gamma proteobacteria. The gene is part of an operon for the degradation of xanthosine and is induced by xanthosine. The enzyme is also capable of acting on inosine and guanosine (but not adenosine) in a manner similar to those other phosphorylases to which it is closely related (TIGR01698, TIGR01700).
Statistics
?
PSSM-Id: 130760
View PSSM: TIGR01699
Aligned: 3 rows
Threshold Bit Score: 371.698
Threshold Setting Gi: 66361144
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YQQ_A    27 RVAFILGSGLGALADQIENAVAISYEKLPGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTFKL 106 Escherichia coli K-12
CAC90012  35 QIAFILGSGLGDLVDQITNDTTISYADIPGFPVSSVHGHAGELVLGDLCGVPVMCMKGRGHFYEGKGMSIMTNPVRTFKL 114 Yersinia pestis CO92
P45563    27 RVAFILGSGLGALADQIENAVAISYEKLPGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTFKL 106 Escherichia coli K-12
1YQQ_A   107 LGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPGTPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKEEGFPLTEG 186 Escherichia coli K-12
CAC90012 115 MGCEFLFCTNAAGSLRPEVLPGSVVMLKDHINTMPGTPLVGPNDDRFGPRFFSLANAYDKDLRADMAKIAQQLDIPLTEG 194 Yersinia pestis CO92
P45563   107 LGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPGTPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKEEGFPLTEG 186 Escherichia coli K-12
1YQQ_A   187 VFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEGLSDVKLSHAQTLAAAELSKQNFI 266 Escherichia coli K-12
CAC90012 195 VFVSYLGPCFETPAEIRMMQIIGGDVVGMSVVPEVLSAAHCGLKVIALTAITNLAEGLSDVVLSHEQTLKFAKVASVNFT 274 Yersinia pestis CO92
P45563   187 VFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEGLSDVKLSHAQTLAAAELSKQNFI 266 Escherichia coli K-12
1YQQ_A   267 NLICGFLR 274 Escherichia coli K-12
CAC90012 275 KLIEAFLK 282 Yersinia pestis CO92
P45563   267 NLICGFLR 274 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap