1G2O,1C3X


Conserved Protein Domain Family
PUNP

?
TIGR01698: PUNP 
Click on image for an interactive view with Cn3D
purine nucleotide phosphorylase
This clade of purine nucleotide phosphorylases has not been experimentally characterized but is assigned based on strong sequence homology. Closely related clades act on inosine and guanosine (PNPH, TIGR01700), and xanthosine, inosine and guanosine (XAPA, TIGR01699) neither of these will act on adenosine. A more distantly related clade (MTAP, TIGR01694) acts on methylthioadenosine.
Statistics
?
PSSM-Id: 130759
View PSSM: TIGR01698
Aligned: 6 rows
Threshold Bit Score: 305.211
Threshold Setting Gi: 18075994
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1G2O_A        29 DVAVVLGSGWLPAVAALGSp-TtVLPQAELPGFVPPTAAGHAG--ELLSVPIGAHRV---LVLAGRIHAYEGHDLRYVVH 102 Mycobacterium t...
O53359        29 DVAVVLGSGWLPAVAALGSptT-VLPQAELPGFVPPTAAGHAG--ELLSVPIGAHRV---LVLAGRIHAYEGHDLRYVVH 102 Mycobacterium t...
P81989        39 DMALVLGSGWGGAAELLGEvvA-EVPTHEIPGFSAPAVAGHLSvtRSIRVERADGSVrhaLVLGSRTHLYEGKGVRAVVH 117 Cellulomonas sp.
WP_010968372  18 RYGIVLGSGLGSLVDAVAEp-L-RIPYAEIPGFPVSSVSGHAG--EFVAGRIGDTPV---AVLSGRAHYYERGDAKAMRV 90  Sinorhizobium m...
CAD20226      21 ALAIVTGTGLGALVEAVADr-V-SLDYGAIPGFPAPGVSGHGG--RLHRGRLSGRPV---LVFEGRTHAYETGDAAAMRV 93  Methylobacteriu...
1C3X_A        31 DMALVLGSGWGGAAELLGEv-VaEVPTHEIPGFSSVT--------RSIRVERADGSVrhaLVLGSRTHLYEGKGVRAVVH 101 Cellulomonas sp.
1G2O_A       103 PVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVG----GEFVDLTDAYSPRLR----ELARQSDPQ 174 Mycobacterium t...
O53359       103 PVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVG----GEFVDLTDAYSPRLR----ELARQSDPQ 174 Mycobacterium t...
P81989       118 GVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINLTARSPLEG----PTFVDLTDVYSPRLR----ELAHRVDPT 189 Cellulomonas sp.
WP_010968372  91 PIETLKRIGVENLILTNSAGSLREDMPPGSVMRIADHIAFAGANPLIGlesdERFVGMTNAYDAALAigmeEAAERLGIP 170 Sinorhizobium m...
CAD20226      94 PLAAARALGAALLLLTNAAGSLRPEIGPGRLVMLADHINLSGLNPLIGepsdARFVSMTEAYDPGLRahlsAAAEAIGLP 173 Methylobacteriu...
1C3X_A       102 GVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINLTARSPLEG----PTFVDLTDVYSPRLR----ELAHRVDPT 173 Cellulomonas sp.
1G2O_A       175 LAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASA 254 Mycobacterium t...
O53359       175 LAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASA 254 Mycobacterium t...
P81989       190 LPEGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTNLAAGISPTPLSHAEVIEAGQAAG 269 Cellulomonas sp.
WP_010968372 171 LARGVYMWFSGPSFETPAEIRMARILGADAVGMSTVPEVILARFFGLKVAAASVVTNFAAGMTGSELSHEETKQMAPLGG 250 Sinorhizobium m...
CAD20226     174 LPAGVYAWFSGPSFETPAEVRMAGILGADLVGMSTVPETILARFLGMPVAAISVVTNLAAGIAGGDPHHAETKAVAARAG 253 Methylobacteriu...
1C3X_A       174 LPEGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTNLAAGISPTPLSHAEVIEAGQAAG 253 Cellulomonas sp.
1G2O_A       255 TRMGALLADVIA 266 Mycobacterium tuberculosis H37Rv
O53359       255 TRMGALLADVIA 266 Mycobacterium tuberculosis
P81989       270 PRISALLADIAK 281 Cellulomonas sp.
WP_010968372 251 TRLAAILKEMIS 262 Sinorhizobium meliloti
CAD20226     254 ADLARLVTGFVG 265 Methylobacterium extorquens CM4
1C3X_A       254 PRISALLADIAK 265 Cellulomonas sp.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap