1TCU,1YQQ


Conserved Protein Domain Family
PNPH-PUNA-XAPA

?
TIGR01697: PNPH-PUNA-XAPA 
Click on image for an interactive view with Cn3D
inosine/guanosine/xanthosine phosphorylase family
This model is a subset of the subfamily represented by pfam00896 (phosphorylase family 2). This model excludes the methylthioadenosine phosphorylases (MTAP, TIGR01684) which are believed toplay a specific role in the recycling of methionine from methylthioadenosine. In this subfamily is found three clades of purine phosphorylases based on a neighbor-joining tree using the MTAP family as an outgroup. The highest-branching clade (TIGR01698) consists of a group of sequences from both gram positive and gram negative bacteria which have been annotated as purine nucleotide phosphorylases but have not been further characterized as to substrate specificity. Of the two remaining clades, one is xanthosine phosphorylase (XAPA, TIGR01699), is limited to certain gamma proteobacteria and constitutes a special purine phosphorylase found in a specialized operon for xanthosine catabolism. The enzyme also acts on the same purines (inosine and guanosine) as the other characterized members of this subfamily, but is only induced when xanthosine must be degraded. The remaining and largest clade consists of purine nucleotide phosphorylases (PNPH, TIGR01700) from metazoa and bacteria which act primarily on guanosine and inosine (and do not act on adenosine). Sequences from Clostridium (GP:15025051) and Thermotoga (OMNI:TM1596) fall between these last two clades and are uncharacterized with respect to substrate range and operon.
Statistics
?
PSSM-Id: 130758
View PSSM: TIGR01697
Aligned: 11 rows
Threshold Bit Score: 346.258
Threshold Setting Gi: 499210346
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TCU_A        28 EIGIICGSGLGKLADGV-Kd-KITIPYTKIPNFPQTSVVGHSGNLIFGTLSGR--KVVVMQGRFHMYEG-YSNDTVALPI 102 Schistosoma man...
BAB82201      23 TIGLILGSGLGAIADQI-Ed-AEYFPYNEIPNFPVSTVEGHAGRLVIGKFQGK--EVVAMQGRFHYYEG-YSMQEVTCPV 97  Clostridium per...
AAK09382      28 EIGIICGSGLGKLADGV-Kd-KITIPYTKIPNFPQTSVVGHSGNLIFGTLSGR--KVVVMQGRFHMYEG-YSNDTVALPI 102 Schistosoma man...
AAC02605      44 DLGIICGSGLGPIGDTV-Qd-ATILPYSKIPGFPTTHVVGHKGNMIFGKLGGK--KVVCLQGRFHPYEHnMDLALCTLPV 119 Caenorhabditis ...
CAD07654      27 RVAFILGSGLGALADQI-Ed-AVAISYEKLPGFPVSTVHGHAGELVLGHLAGV--PVACMKGRGHFYEG-RGMAVMTDAI 101 Salmonella ente...
CAB55857      42 KVAIICGSGLGTLASGL-SapVYEVPYEDIPHFHVSHVPGHASKLYFAFLGEKrvPTMILAGRYHSYEG-YPIEATTFPV 119 fission yeast
WP_005874035  24 KTAIILGSGLGELAEKI-En-KTVIPYNEIPHFAQATAVGHKGNIIGGILGGT--PVVAMQGRFHYYEG-YSMDQVTFPI 98  Porphyromonas g...
1YQQ_A        27 RVAFILGSGLGALADQI-En-AVAISYEKLPGFPVSTVHGHAGELVLGHLQGV--PVVCMKGRGHFYEG-RGMTIMTDAI 101 Escherichia coli
WP_004082038  21 DILIILGSGFGPFIEKV-Ed-PVIIDYKDIPHFPQPTVEGHSGKLVFGRISDK--PVMIMAGRFHLYEG-HDPATVAFPV 95  Thermotoga
WP_010970670  19 RVAIVLGSGLGSLVEEV-Sd-PIRVPYANLPGFPTSGVSGHAGELVAGYLGGE--PVMMLSGRVHYYEK-GDPAAMRAVI 93  Agrobacterium f...
WP_010907886  29 DVAVVLGSGWSSAVAALgSs-RAVFPQAELPGFITPNAAGHTGELLSVRIGAH--RVLVLAGRIHPYEG-HDLRHVVHPV 104 Mycobacterium l...
1TCU_A       103 RVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLglnNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEE 182 Schistosoma man...
BAB82201      98 RVMRLLGVETLVVTNAAGAVNKDYTPGDLMIISDHLNLSGS---NPLIGKNLNEFGTRFPDMSNAYDKALRAQVKDIAKN 174 Clostridium per...
AAK09382     103 RVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLglnNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEE 182 Schistosoma man...
AAC02605     120 RVMHQLGIKIMIVSNAAGGINAVLRHGDLMLIKDHIFLPALagfSPLVGCNDPRFGARFVSVHDAYDKQLRQLAIDVGRR 199 Caenorhabditis ...
CAD07654     102 RTLKLLGCEVLFCTNAAGSLRPEVGPGSLVALSDHINTMPG---TPMVGPNDDRYGDRFFSLANAYDADYRAMLQSVAAE 178 Salmonella ente...
CAB55857     120 RLMKVMGVEVMVVTNAAGGLNQGFKVGDLMILKDHINFPGLagmNPLRGPNAHEFGVRFPPLSDAYDLELRKLVYDAAKA 199 fission yeast
WP_005874035  99 RVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHINNLP----NPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQE 174 Porphyromonas g...
1YQQ_A       102 RTFKLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPG---TPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKE 178 Escherichia coli
WP_004082038  96 YLAKYVGVKGVVVTNAAGAINPEFKPGEIILVRDIINFMFR---NPLRGPNDEKIGPRFPDMSSVVDPEWARKIQERLS- 171 Thermotoga
WP_010970670  94 EALAGLGVQSLILTNSAGSVRQDMPPGSVMQITDHINYSGM---NPLIGEESDR---RFVGMTTAYDPDLMLAMRNAAIR 167 Agrobacterium f...
WP_010907886 105 RTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTR---SPLVG-------THFVDLTNAYTTRLRKL----ASD 170 Mycobacterium l...
1TCU_A       183 NGFGnlVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVldVESDLkpN---- 258 Schistosoma man...
BAB82201     175 LGIE--VREGVYAMFSGPTYETPAEVRMARILGADAVGMSTVPEVIIANHSGMKVIGVSCMTNMAAgiLEQPL--N---- 246 Clostridium per...
AAK09382     183 NGFGnlVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISV--LDVESdlk---- 256 Schistosoma man...
AAC02605     200 SDMT--LYEGVYVMSGGPQYESPAEVSLFKTVGADALGMSTCHEVTVARQCGIKVLGFSLITNIAN--LDADAsve---- 271 Caenorhabditis ...
CAD07654     179 KGFP--LTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCGLKVVAVSAITNLAEglGDVKL--S---- 250 Salmonella ente...
CAB55857     200 HKVSrtIHEGCYAFVSGPCFETRAESRMLALMGADCVGMSTVPEVVVARHCGIRVLAISLVTNNVV--VEESP--Sakdl 275 fission yeast
WP_005874035 175 LNIP--VKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYhfADDFV--Nd--- 247 Porphyromonas g...
1YQQ_A       179 EGFP--LTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEglSDVKL--S---- 250 Escherichia coli
WP_004082038 172 ------LKEGVYIGVLGPSYETPAEIRVFEKLGADLVGMSTVPEVIAAKHCGLKVVVFSCVTNMAAgiTHGRL--S---- 239 Thermotoga
WP_010970670 168 ATVP--LFGGVYMWFSGPSFETPAEIRMARVLGADAVGMSTVPEVILARFFGMRVAAASVITNYGAgmTGAEL--S---- 239 Agrobacterium f...
WP_010907886 171 TDPT--LTEGVYAAQPGPHYETPAEIRMLRMLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAgiTGKPL--N---- 242 Mycobacterium l...
1TCU_A       259 --------------HEEVLATGAQRAELMQSWFEKIIE 282 Schistosoma mansoni
BAB82201     247 --------------HEEVMETSAKVRKTFIELMTNIIK 270 Clostridium perfringens str. 13
AAK09382     257 ------------pnHEEVLATGAQRAELMQSWFEKIIE 282 Schistosoma mansoni
AAC02605     272 ------------vsHEEVMDIAQQAGERASRFVSDIIT 297 Caenorhabditis elegans
CAD07654     251 --------------HAQTLAAAELSRQNFINLICGFLR 274 Salmonella enterica subsp. enterica serovar Typhi str. CT18
CAB55857     276 vevdsnvmskgaanHLEVLEVGIAAAADVRTMVETIVN 313 fission yeast
WP_005874035 248 --------------EQDVIRAANAASEKMGAIFARLIA 271 Porphyromonas gingivalis
1YQQ_A       251 --------------HAQTLAAAELSKQNFINLICGFLR 274 Escherichia coli
WP_004082038 240 --------------HEEVVRTTKMAQGKIEKALTTAVE 263 Thermotoga
WP_010970670 240 --------------HEETKDMAPVGGKRLAAILKEMIA 263 Agrobacterium fabrum
WP_010907886 243 --------------HAEVLAAGTASANRIGSLLADIIA 266 Mycobacterium leprae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap