Conserved Protein Domain Family
deoB

?
TIGR01696: deoB 
phosphopentomutase
This protein is involved in the purine and pyrimidine salvage pathway. It catalyzes the conversion of D-ribose 1-phosphate to D-ribose 5-phosphate and the conversion of 2-deoxy-D-ribose 1-phosphate to 2-deoxy-D-ribose 5-phosphate. The seed members of this protein are characterized deoB proteins from E.Coli(SP:P07651) and Bacillus (SP:P46353). This model matches pfam01676 for Metalloenzyme superfamily. [Purines, pyrimidines, nucleosides, and nucleotides, Other]
Statistics
?
PSSM-Id: 162494
View PSSM: TIGR01696
Aligned: 3 rows
Threshold Bit Score: 683.544
Threshold Setting Gi: 729312
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P46353         8 RVFLIVMDSVGIGEAPDAADFNDEGAHTLGHIAEHMNG----------LHMPNMAKLGLGLIED------IKGVEKTEHP 71  Bacillus subtil...
P07651         3 RAFIMVLDSFGIGATEDAERFGDVGADTLGHIAEACAKgeadngrkgpLNLPNLTRLGLAKAHEgstgfiPAGMDGNAEV 82  Escherichia coli
WP_031808258   3 RVHLIVMDSVGIGEAPDAADFKDEGSHTLRHTLEGFD-----------QTLPNLEKLGLGNIDK------LPVVNAVEQP 65  Staphylococcus ...
P46353        72 LAYYGKMQEASNGKDTMTGHWEIMGLYIDKPFKVFP---EGFPDELLQELEKRSGRK-IIGNKPASGTAILDELGQEHME 147 Bacillus subtil...
P07651        83 IGAYAWAHEMSSGKDTPSGHWEIAGVPVLFEWGYFSdheNSFPQELLDKLVERANLPgYLGNCHSSGTVILDQLGEEHMK 162 Escherichia coli
WP_031808258  66 EAYYTKLSEASVGKDTMTGHWEIMGLNIMQPFKVYP---NGFPEELIQQIEEMTGRK-VVANKPASGTQIIDEWGEHQMK 141 Staphylococcus ...
P46353       148 TGALIVYTSADSVLQIAAHEEVVPLEELYRICETARELTLDPKYMVGRIIARPFVGE-PGQFKRTPNRHDYALKPFDRTV 226 Bacillus subtil...
P07651       163 TGKPIFYTSADSVFQIACHEETFGLDKLYELCEIAREELTNGGYNIGRVIARPFIGDkAGNFQRTGNRHDLAVEPPAPTV 242 Escherichia coli
WP_031808258 142 TGDLIVYTSADPVLQIAAHEDIIPLEELYDICEKVRELTKDPKYLIGRIIARPYVGE-PGNFTRTSNRHDYALKPFGKTV 220 Staphylococcus ...
P46353       227 MNELKDCGL-DVISIGKISDIYDGEGITSSRRTVSNMDGMDKVIDTLGEDFTG-LSFANLVDFDALFGHRRDPEGYGRAL 304 Bacillus subtil...
P07651       243 LQKLVDEKHgQVVSVGKIADIYANCGITKKVKATGLDALFDATIKEMKEAGDNtIVFTNFVDFDSSWGHRRDVAGYAAGL 322 Escherichia coli
WP_031808258 221 LDHLKDGGY-DVIAIGKINDIYDGEGVTEAVRTKSNMDGMDQLMKIVKKDFTG-ISFLNLVDFDALYGHRRDKPGYAQAI 298 Staphylococcus ...
P46353       305 EEFDARLPEVFEKMREDDLLIITADHGNDPIHHGTDHTREYVPILAYSKKHKKAqMLPLADTFADIGATIADNFQTNKPK 384 Bacillus subtil...
P07651       323 ELFDRRLPELMSLLRDDDILILTADHGCDPTWTGTDHTREHIPVLVYGPKVKPG-SLGHRETFADIGQTLAKYFGTSDME 401 Escherichia coli
WP_031808258 299 KDFDDRLPELFSNLKEDDLVIITADHGNDPTAPGTDHTREYIPVIMYSPKFKGGhALESDTTFSSIGATIADNFNVTLPE 378 Staphylococcus ...
P46353       385 YGKS 388 Bacillus subtilis subsp. subtilis str. 168
P07651       402 YGKA 405 Escherichia coli
WP_031808258 379 FGKS 382 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap