2I9P


Conserved Protein Domain Family
HIBADH

?
TIGR01692: HIBADH 
Click on image for an interactive view with Cn3D
3-hydroxyisobutyrate dehydrogenase
3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway. In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators. 3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterized 3-hydroxyisobutyrate dehydrogenase from rat liver with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31). This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate. HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase above trusted (pfam03446). [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130753
View PSSM: TIGR01692
Aligned: 6 rows
Threshold Bit Score: 390.313
Threshold Setting Gi: 499221691
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2I9P_A        27 FIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKV 106 human
CAD17800       5 FIGLGNMGAPMARNLLKAGHALSVFDLDARAVQSLVDAGASAAPSPKAAATGADCAITMLPAAAHVHSVLTADDGILAGI 84  Ralstonia solan...
P29266        43 FIGLGNMGNPMAKNLIKHGYPLILYDVFPDVCKEFKEAGEQVASSPADVAEKADRIITMLPSSMNSIEVYSGANGILKKV 122 Norway rat
P28811         6 FLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVISMLPAGQHVESLYLGDDGLLARV 85  Pseudomonas aer...
WP_004683962   6 FIGLGNMGGPMAANLVKAGHTVRGFDLLPQHLEEAKANGLEIAASAAEAVSDVDAVITMLPAGKHVISVY---EDIAPKA 82  Brucella
WP_010919231   6 FIGLGNMGGGMAANQAKAQHQVRAFDLSAAAVERAVAAGCLAAASVAEAVAEAEIVITMLPAGPHVRAVYA--EQILPNA 83  Caulobacter vib...
2I9P_A       107 KKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVG 186 human
CAD17800      85 AKGVPIIDSSTIDPDSAKALAALATAHGNPFVDAPVSGGTGGAAAGTLTFMVGGGAAVFEQVRPVLSAMGKNLVHCGEAG 164 Ralstonia solan...
P29266       123 KKGSLLIDSSTIDPSVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVENEFAAAQELLGCMGSNVLYCGAVG 202 Norway rat
P28811        86 AGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPVSGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHG 165 Pseudomonas aer...
WP_004683962  83 RKDSLFVDCSTIDVDSARKAHELAATHGHLSIDAPVSGGTGGAAAGTLTVMAGGSEEAFKRGEPILQPMAGKIVHCGGDG 162 Brucella
WP_010919231  84 PKSALLIDCSTIDVDSARVVARQAAEAGFRFADAPVSGGIMAAEAGTLAFMVGCEASDFAAVEAALAPMSRVTIHAGDHG 163 Caulobacter vib...
2I9P_A       187 TGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMA 266 human
CAD17800     165 AGQGAKICNNLVLGITMAGVAEAMSLGEALGIDPKVLGGIINTSTGRCWSSDTYNPFPGVIETAPSSRGYTGGFGTDLML 244 Ralstonia solan...
P29266       203 SGQSAKICNNMLLAISMIGTAEAMNLGIRSGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSSNNYQGGFGTTLMA 282 Norway rat
P28811       166 AGQVAKICNNMLLGILMAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQVRLMN 245 Pseudomonas aer...
WP_004683962 163 AGQAAKICNNMILGISMIGVSEAFVLAEKLGLSHQALFDVASTSSGQCWSLTTYCPVPGPVPASPANNDYKPGFAAALML 242 Brucella
WP_010919231 164 AGQAAKICNNMLLGVSMLGTCEAFALAEKLGLAADRFFEIASKSSGQCWSITSYCPVPGVGPQTPADRGYEGGFASAMML 243 Caulobacter vib...
2I9P_A       267 KDLGLAQDSATSTKSPILLGSLAHQIYRMMC--AKGYSKKDFSSVFQFLR 314 human
CAD17800     245 KDLGLAGDAAKSVRQPVYLGALAQQLYQASS--SQGAGKLDFSAVIRLYR 292 Ralstonia solanacearum GMI1000
P29266       283 KDLGLAQDSATSTKTPILLGSVAHQIYRMMC--SKGYSKKDFSSVFQYLR 330 Norway rat
P28811       246 KDLGLALANAQAVQASTPLGALARNLFSLHAqaDAEHEGLDFSSIQKLYR 295 Pseudomonas aeruginosa PAO1
WP_004683962 243 KDLKLSQEAAKSAGAETPLGAHARELYSRFD--DEGHGGEDFSGIINFLR 290 Brucella
WP_010919231 244 KDLKLAQEAAAKAGASTPMGAQAEALYALFD--ANGFGGKDFSAVIELLR 291 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap