Conserved Protein Domain Family
ICE_RAQPRD

?
TIGR01690: ICE_RAQPRD 
integrative conjugative element protein, RAQPRD family
This model represents a small family of proteins about 100 amino acids in length, including a predicted signal sequence and a perfectly conserved motif RAQPRD towards the C-terminus. Members are found in the Pseudomonas putida TOL plasmid pWW0 and in cryptic plasmid regions of Salmonella enterica subsp. enterica serovar Typhi and Pseudomonas syringae DC3000. The function is unknown. [Mobile and extrachromosomal element functions, Plasmid functions]
Statistics
?
PSSM-Id: 162489
View PSSM: TIGR01690
Aligned: 17 rows
Threshold Bit Score: 100.506
Threshold Setting Gi: 500117685
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011271843  14 NIFSLSLAIGLLFGAISAQATEQEHLAQAIKQLDAAKLSLQRAAASAKvSAKS-REYFDYASAHQDIATVQAGIKQYINP 92  Haemophilus inf...
WP_003141512  19 CLAVLACSALVAQGAFAASASEQANLEVMIRQLNALEDTARRSAQGAD-EPGQ-RFYFDYPRLAADLQRIRQGLQDYMTP 96  Pseudomonas aer...
WP_003317499  20 TAVLLCTPLLSTYAQAAGTASEQANVEVMIRQLNALEAVAQRSADLPNeSA-Q-RYHLDYPRLVSDISRIRQGLQDYLTP 97  Pseudomonas syr...
WP_011334412   8 CFLLLSLAIVH-GSSYAASAHEQSQLSLILQQLDIIERLATQAETASTaEPND-RYRFDYPRLTQDIQRIRQGVQSYLFP 85  Pseudomonas flu...
WP_011062955  18 LAMIVAGGIAVSPVVEAATASEQTNIEVMVRQLNALEDSARRSSVIAG-EPGQ-RYYFDYDRLAADIQRIRQGLQAYLTP 95  Pseudomonas pro...
WP_010944872   9 SLFILCGCL---GMTMLAQATEQEQLEQAIKQMDAAKLSLQRAAQQAKtSVKS-REFFDYTAAQRDITTVQEGIKQYINP 84  Haemophilus duc...
WP_032466046   3 LFPKLSVLLLTTASTLPIQAAEKDELALVMRQLDQVQASFDRARVVANqNGLDaRFYFDYLSAINDITTMKQGIENYLAP 82  Yersinia pseudo...
WP_012052657  12 aSFALLLSCVVSLGAVAQDAPERSDLGLVQRQLKAIELLADRASSGSVdSAGA-RFRFDYSRFAADLKLMRQGIQQYLSP 90  Pseudomonas put...
WP_011609899   6 sgkkvlfAVSMSMMALAVQASEKAQLAQAIKQLEAAQLSLKRAEAVAQtSEKN-REYFDYQAARRDINAIKSGINQYINP 84  Histophilus somni
WP_002812402   9 TFLILGLCVAPAA--FADADAEREALAKIIHELNALETLINRAEVNADrDSRI-RFRYDW--LRQDLKQIKDGIQSHIDS 83  Nitrosococcus o...
WP_011271843  93 SRAIPRNPK---AIRnlkEDY 110 Haemophilus influenzae
WP_003141512  97 SRAQPRDPS---DLS---GNY 111 Pseudomonas aeruginosa
WP_003317499  98 SRAQPRDPV---EIS---GHY 112 Pseudomonas syringae
WP_011334412  86 SRAQPRDPT---ELV---GDY 100 Pseudomonas fluorescens
WP_011062955  96 SRAQPRDAA---DLS---GQY 110 Pseudomonas protegens
WP_010944872  85 SRAIPRNPKavrALT---EDY 102 Haemophilus ducreyi
WP_032466046  83 SRAQPSLPM---SVT---GQY 97  Yersinia pseudotuberculosis
WP_012052657  91 SRAQPADLV---ELT---GNY 105 Pseudomonas putida group
WP_011609899  85 ARAIPRDPN---ASRrlqEDY 102 Histophilus somni
WP_002812402  84 PRAQPRSFP---PLR---GDY 98  Nitrosococcus oceani
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap