Conserved Protein Domain Family
Veg_Stor_Prot

?
TIGR01680: Veg_Stor_Prot 
vegetative storage protein
The proteins represented by this model are close relatives of the plant acid phosphatases (TIGR01675), are limited to members of the Phaseoleae including Glycine max (soybean) and Phaseolus vulgaris (kidney bean). These proteins are highly expressed in the leaves of repeatedly depodded plants. VSP differs most strinkingly from the acid phosphatases in the lack of the conserved nucleophilic aspartate residue in the N-terminus, thus, they should be inactive as phosphatases. This issue was confused by the publication in 1992 of an article claiming activity for the Glycine max VSP. In 1994 this assertion was refuted by the separation of the activity from the VSP.
Statistics
?
PSSM-Id: 130741
View PSSM: TIGR01680
Aligned: 2 rows
Threshold Bit Score: 546.248
Threshold Setting Gi: 1816410
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P10742     1 KVLVFFVATILVAWQCH--AYDMFPLRMNTGYGA--RTPEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRS 76  soybean
BAA19152   2 KCLVFFVAAVLVASQCHgaSFRSFPLSMTTGYGHgaSDTEVRCASWRLAVEAQNIFGFETIPQQCVDATANYIEGGQYRS 81  Phaseolus vulgaris
P10742    77 DSKTVNQQAYFYARDLEVHPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYD-EWVNKGNAPALPETLKNYNKLVSL 155 soybean
BAA19152  82 DSKTVNQQIYFFARDRHVHENDVILFNIDGTALSNIPYYSQHGYGSEKFDSERYDeEFVNKGEAPALPETLKNYNKLVSL 161 Phaseolus vulgaris
P10742   156 GFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPqDPSTPNAVSYKTAAREKLIRQGYNIVGIIGDQWSDLLGGHR 235 soybean
BAA19152 162 GYKIIFLSGRLKDKRAVTEANLKKAGYNTWEKLILKDP-SNSAENVVEYKTAERAKLVQEGYRIVGNIGDQWNDLKGENR 240 Phaseolus vulgaris
P10742   236 gESRTFKLPNPcttfsssftsqqssllpiyLYVIR 270 soybean
BAA19152 241 -AIRSFKLPNP-------------------MYYTK 255 Phaseolus vulgaris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap