Conserved Protein Domain Family
bact_FAD_ox

?
TIGR01679: bact_FAD_ox 
FAD-linked oxidoreductase
This model represents a family of bacterial oxidoreductases with covalently linked FAD, closely related to two different eukaryotic oxidases, L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae.
Statistics
?
PSSM-Id: 130740
View PSSM: TIGR01679
Aligned: 3 rows
Threshold Bit Score: 710.117
Threshold Setting Gi: 489503862
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010915436   8 WSNWSGFVTAEPRLIASPADAGELGDLVRTAPGP---VRVVGAGHSFTPLVKSQGTILSLEKLEGLVSHDpqKHQARVKA 84  Mesorhizobium loti
WP_010919101  50 WRNWSGVQHAYPAARLAPKDEGELATALKVAQAP---IRPVGSGHSFTALAPTDGTLVSLDSMSGIVGWE--GDEAIVRA 124 Caulobacter vib...
WP_003408749   5 WSNWPGEQVCAPSAIVRPTSEAELADVIAQAAKRgerVRAVGSGHSFTDIACTDGVMIDMTGLQRVLDVDqpTGLVTVEG 84  Mycobacterium t...
WP_010915436  85 GTRLGPLMHILQGIGQGLPNMGDIDRQAIGGALGTATHGSGPTLGAYHTQLETVQIVDGLGKVRDFTRAGDQDMIHAIGV 164 Mesorhizobium loti
WP_010919101 125 GTRLGALGPLLAEKGRALANLPDINKQSLGGALGTATHGTGIKIPAMHGDVTGLRLVTPSGKIIDADASNNPEIFQAARV 204 Caulobacter vib...
WP_003408749  85 GAKLRALGPQLAQRRLGLENQGDVDPQSITGATATATHGTGVRFQNLSARIVSLRLVTAGGEVLSLSEGDD---YLAARV 161 Mycobacterium t...
WP_010915436 165 ALGAFGVLSEVTLNNIATYRLRRRKWVLPIGDMLRDFEKMMTAHRSAEFYYIPFSGYAQFIASDFSTEATTT---RPTDD 241 Mesorhizobium loti
WP_010919101 205 SMGALGVISQVRMRTSANRRLRRRVWLEPFEEAMAKADGRWAQHRNFEFYAVPFTGLAVNITHDETDDPAEA---RGPDQ 281 Caulobacter vib...
WP_003408749 162 SLGALGVISQVTLQTVPLFTLHRHDQRRSLAQTLERLDEFVDGNDHFEFFVFPYADKALTRTMHRSDEQPKPtpgWQRMV 241 Mycobacterium t...
WP_010915436 242 DEGSL-RTLRRLRTGLAWLPSLRRRLILGAVAKVPSEDYVQDWLNVYASDRQTKFNEMEYHLPFEEGPKALAEIIELTEK 320 Mesorhizobium loti
WP_010919101 282 DVEFL-QALRGLRNLLGFATPLRKAAAKALLSSAKPESSVDEGWKLLSTERPVRFNEMEFHLPVENQLKALEEVMRTIET 360 Caulobacter vib...
WP_003408749 242 GENFEnGGLSLICQTGRRFPSVAPRLNRLMTNMMSSSTVQDRAYKVFATQRKVRFTEMEYAIPRENGREALQRVIDLVRR 321 Mycobacterium t...
WP_010915436 321 RFPEVYFPMEVRSVAPDKFWLSPFYNRPTCSIAIHHDAASDPLPFMQAAEPIFRRYGGRPHWGKMHSLKAADFKKLYPRW 400 Mesorhizobium loti
WP_010919101 361 ERPDVFFPIEVRRIAADDAWLSPFYAAPRGSVAVHAYYRDDFTFLYELIEPIFRRYEGRPHWGKLHTLRGRQLEAIYPRW 440 Caulobacter vib...
WP_003408749 322 RSLPIMFPIEVRFSAPDDSFLSTAYGRDTCYIAVHQYAGMEFESYFRAVEEIMDDYAGRPHWGKRHYQTAATLRERYPQW 401 Mycobacterium t...
WP_010915436 401 DDAMAVRRDIDPQNRFVSPYMAGLFG 426 Mesorhizobium loti
WP_010919101 441 KDFLEVRQDLDPEARMLNPYLKGLFG 466 Caulobacter vibrioides
WP_003408749 402 DRFAAVRDRLDPDRVFLNDYTRRVLG 427 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap