Conserved Protein Domain Family
GLDHase

?
TIGR01676: GLDHase 
galactonolactone dehydrogenase
This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.
Statistics
?
PSSM-Id: 130737
View PSSM: TIGR01676
Aligned: 2 rows
Threshold Bit Score: 1155.2
Threshold Setting Gi: 20279572
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA87934  47 ESELRKYIGYTLLLLGCGAATYYSFPFPENAKHKKAQLFRYAPLPDDLHTVSNWSGTHEVQTRTFLQPEAIEELEGIVKT 126 common tobacco
AAF64319  50 DSELRKYLGYGALVIFCGAATYYSFPFPENAKHKKAQIFRYAPLPEDLHTVSNWSGTHEVLTRVFHQPEDLEQLEQVVKQ 129 muskmelon
BAA87934 127 ANEKKQRIRPVGSGLSPNGIGLTRAGMVNLALMDMVLYVDEEKKTVTVQAGIRVQQLVDAIKEYGITLQNFASIREQQIG 206 common tobacco
AAF64319 130 ANEKKARVRPVGSGLSPNGIGLSRLGMVNMALMDKVLEVDKEKKRVRVQAGIRVQQLVDGIKEYGLTLQNFASIREQQIG 209 muskmelon
BAA87934 207 GIVQVGAHGTGAKLPPIDEQVISMKLVTPAKGTIEISKEKDPELFYLARCGLGGLGVVAEVTLQCVERQELVEHTFLSNM 286 common tobacco
AAF64319 210 GIIQVGAHGTGAKLPPIDEQVIAMKLVTPAKGTIEISNDKDPELFFLARCGLGGLGVVAEVTLQCVERQELVEHTYISNM 289 muskmelon
BAA87934 287 KDIKKNHKKFLSDNKHVKYLHIPYTDAVVVVTCNPISKSRGPPKHKPKYTTEEALQHVRVLYRESLKKYRgqvadsGSPE 366 common tobacco
AAF64319 290 KDIKKNHKKLLADNKHVKYLYIPYTDAIVVVTCNPISKWRGPPKFKPKYTSEEAIQHVRDLYVESLKKYS------ASEE 363 muskmelon
BAA87934 367 PEIDELSFTELRDKLLALDPLNKVHVIEINKAEVEFWRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDL 446 common tobacco
AAF64319 364 RDINEFSFTELRDKLLALDPLNKEHVMKVNQAEAEFWRKSEGYKVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDI 443 muskmelon
BAA87934 447 EYIEELMQLIEKESVPAPAPIEQRWTACSKSRMSPAYSSADDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMTQAQL 526 common tobacco
AAF64319 444 EYIEELKQLIEKENIPAPAPLEQRWTGRSKSPMSPASSTAEDDIFSWVGIIMYLPTSDARQRKEITEEFFHYRHLTQTLL 523 muskmelon
BAA87934 527 WDHYSAFEHWAKIEVPKDKEELAALQERLKKKFPVDAYNQARKELDPNRILSNNMLEKLFI 587 common tobacco
AAF64319 524 WDKFSAFEHWAKIEVPKDKDELAALQARLRKRFPVDESNKARRALDPNKILSNNKLEKLFS 584 muskmelon
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap