Conserved Protein Domain Family

TIGR01673: holin_LLH 
phage holin, LL-H family
This model represents a putative phage holin from a number of phage and prophage regions of Gram-positive bacteria. Like other holins, it is small (about 100 amino acids) with stretches of hydrophobic sequence and is encoded adjacent to lytic enzymes. [Mobile and extrachromosomal element functions, Prophage functions]
PSSM-Id: 130734
Aligned: 5 rows
Threshold Bit Score: 85.2829
Threshold Setting Gi: 499336494
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
AAK27916      80 FYADAHLPAPSDAQVSGAIEKAVAIMKMSS 109 Lactobacillus johnsonii prophage Lj965
AAK27939      81 ILDMAHLPHPSTAYIKGEIEKLITTMKQAK 110 Lactobacillus prophage Lj928
AAC00556      77 QLKAKGITGIDEKMVYGAVETAWKEAIENV 106 Lactobacillus phage LL-H
AAM83087      72 EAKKLKI-KTNPAQIEAQIEASLAQLKKNF 100 Lactococcus phage 4268
WP_011026451  74 VIGN----KLTDEEIDKLIEAAVFEMNYVL 99  Caldanaerobacter subterraneus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap