3I6B


Conserved Protein Domain Family
KdsC-phosphatas

?
TIGR01670: KdsC-phosphatas 
Click on image for an interactive view with Cn3D
3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family
This family of proteins is a member of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases. All characterized members of this subfamily (TIGR01662) and most characterized members of the HAD superfamily are phosphatases. HAD superfamily phosphatases contain active site residues in several conserved catalytic motifs, all of which are found conserved here. One member of this family, the YrbI protein from H. influenzae has been cloned, expressed, purified and found to be an active 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase. Furthermore, its crystal structure has been determined. This family consists of sequences from beta, gamma and epsilon proteobacteria, Aquifex, Fusobacterium, Porphyromonas and Methanosarcina. The Methanosarcina sequence is distinctive in that it is linked to an N-terminal cytidylyltransferase domain (pfam02348) and is annotated as acylneuraminate cytidylyltransferase. This may give some clue as the function of these phosphatases. Several eukaryotic sequences scoring between trusted and noise are also closely related to this function such as the CMP-N-acetylneuraminic acid synthetase from mouse, but in these cases the phosphatase domain is clearly inactive as many of the active site residues are not conserved. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 130731
View PSSM: TIGR01670
Aligned: 4 rows
Threshold Bit Score: 236.653
Threshold Setting Gi: 499183885
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3I6B_A        26 IRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIA 105 Escherichia coli B
P45396        26 IRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIA 105 Escherichia coli
WP_002852221   2 TELIFLDVDGCLTDGKIIYTSNGEFIKEFNVKDGAAIEAWLKLGKKIAIITGRNCPCVEKRAKDLKIKILYQGIKDKLAC 81  Campylobacter j...
WP_010881425  10 LKLLIMDIDGVLTDGKLYYTEHGETIKVFNVLDGIGIKLLQKMGITLAVISGRDSAPLITRLKELGVEEIYTGSYKKLEI 89  Aquifex aeolicus
3I6B_A       106 FSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGK 179 Escherichia coli B
P45396       106 FSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGK 179 Escherichia coli
WP_002852221  82 AKEILQKLNLDFSQCAAIGDYFNDKALLESVGLSFKPKDGHKDLN--VDIVLSKKGGKAAVAQMIEILVEKNHL 153 Campylobacter jejuni
WP_010881425  90 YEKIKEKYSLKDEEIGFIGDDVVDIEVMKKVGFPVAVRNAVEEVRKVAVYITQRNGGEGALREVAELIHFLKND 163 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap