Conserved Protein Domain Family
YCCS_YHJK

?
TIGR01667: YCCS_YHJK 
integral membrane protein, YccS/YhfK family
This model represents two clades of putative transmembrane proteins including the E. coli YccS and YhfK proteins. The YccS hypothetical equivalog (TIGR01666) is found in beta and gamma proteobacteria, while the smaller YhfK group is only found in E. coli, Salmonella and Yersinia. TMHMM on the 19 hits to this model shows a consensus of 11 transmembrane helices separated into two clusters, an N-terminal cluster of 6 and a central cluster of 5. This would indicate two non-membrane domains one on each side of the membrane
Statistics
?
PSSM-Id: 130728
View PSSM: TIGR01667
Aligned: 4 rows
Threshold Bit Score: 857.217
Threshold Setting Gi: 14917084
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44289         2 NIRLNAKVISTIPVFIAVNIAAVGIWFFDISSQSMPLILGIIAGGLVDLDNRLTGRLKNVFFTLIAFSISSFIVQLHIGK 81  Haemophilus inf...
P75870         8 RYTWNSAWLYYARIFIALCGTTAFPWWLGDVKLTIPLTLGMVAAALTDLDDRLAGRLRNLIITLFCFFIASASVELLFPW 87  Escherichia col...
P45537        16 NYALRQTLVLCLPVAVGLMLGELR---FGLLFSLVPACCNI--AGLDTPHKRF---FKRLIIGASLFATCSLLTQLLLAK 87  Escherichia col...
WP_003113274  12 RLWALDKFAYSLRVFIALAGALLLCWWQDRIELLIPLFLGIIASALAETDDNWLGRLQALLVTLLCFSVAAFAVELLFPY 91  Pseudomonas aer...
P44289        82 PIQYIVLMTVLTFIFTMIGAVGQRYSTIAFGSLVVALYTTLTYIp---EVNVWFINPVMILC-GTLLYSVVTLIVYLFFP 157 Haemophilus inf...
P75870        88 PWLFAIGLTLSTSGFILLGGLGQRYATIAFGALLIAIYTMLGTS----LYEHWYQQPMYLLA-GAVWYNVLTLIGHLLFP 162 Escherichia col...
P45537        88 DVPLPFLLTGLTLVLGVTAELGPLHAKLLPASLLAAIFTLSLAG----YMPVW--EPLLIYAlGTLWYGLFNWFWFWIWR 161 Escherichia col...
WP_003113274  92 PWLFVSGMALSAFGMILLGALGERYAAIASATLILSIYTMIGVDqrggEVADVWHEPLLLVA-GAAWYGLLSVLWNALFS 170 Pseudomonas aer...
P44289       158 NRPVQESVAKAFCALGEYLDTKSCFFDPDEVAEIEKKHLNFAMKNANVVTAFNIVRTALFYRIRGQHRHPLTQRMLRYYF 237 Haemophilus inf...
P75870       163 VRPLQDNLARCYEQLARYLELKSRMFDPDIEDQSQAPLYDLALANGLLMATLNQTKLSLLTRLRGDRGQRGTRRTLHYYF 242 Escherichia col...
P45537       162 EQPLRESLSLLYRELADYCEAKYSLL--TQHTDPEKALPPLLVRQQKAVDLITQCYQQMHMLSAQNNTDY--KRMLRIFQ 237 Escherichia col...
WP_003113274 171 NQPVQQSLSRLYFELGEYLRIKSSLFEPLRQLDVEGQRLALARQNGKVVVALNQAKETILNRLGHGRPGPKVSRYLKLYF 250 Pseudomonas aer...
P44289       238 AAQDIHERANSTHFDYQQITEKLKNTDLIFRIQRLLELQAQSCKEITASLRENKPYHFNKRVERALLGTLHSFDLYRa-Q 316 Haemophilus inf...
P75870       243 VAQDIHERASSSHIQYQTLREHFRHSDVLFRFQRLMSMQGQACQQLSRCILLRQPYQHDPHFERAFTHIDAALERMR--D 320 Escherichia col...
P45537       238 EALDLQEHISVSLHQPEEVQKLVERSHAEEVIRWNAQTVAARLRVLADDIL-----YHRLPTRFTMEKQIGALEKIA--- 309 Escherichia col...
WP_003113274 251 IAQDVHERASSSHYPYNRLAEAFFHSDVLFRCQRLLNQQGKACQALARAIRLRQPFDYADR-ELALEDLQASLEHLRqqS 329 Pseudomonas aer...
P44289       317 HLNDQDELIDIQTLLDNLQSINWQLRQLAQDTTVTEQL----AQIHTEQITGLKNISAVIFSHFTFESPLFRHAVRLSIV 392 Haemophilus inf...
P75870       321 NGAPADLLKTLGFLLNNLRAIDAQLATIESEQAQALPHnndeNELADDSPHGLSDIWLRLSRHFTPESALFRHAVRMSLV 400 Escherichia col...
P45537       310 RQHPDNPVGQFCY---------WHFSRIARVLRTQKPLya-rDLLADKQRR--MPLLPALKSYLSLKSPALRNAGRLS-- 375 Escherichia col...
WP_003113274 330 NPAWKGLLRSLGALAANLTTLDRKLAGASNPDAIADEQd---SALLDRSPRSLKDAFERLRQQLTPTSLLFRHGLRMALA 406 Pseudomonas aer...
P44289       393 VFLCCAIVEFFQFNL--GYWILLTTVFVCQPNYSATKVRLRQRIIGTILGVVV-GSLLPYLNPTLEL-KLGLVVLTSTLF 468 Haemophilus inf...
P75870       401 LCFGYAIIQITGMHH--GYWILLTSLFVCQPNYNATRHRLKLRIIGTLVGIAI-GIPVLWFVPSLEG-QLVLLVITGVLF 476 Escherichia col...
P45537       376 VMLSVASLMGTALHLpkSYWILMTVLLVTQNGYGATRLRIVNRSVGTVVGLIIaGVALHFKIP--EGyTLTLMLITTLAS 453 Escherichia col...
WP_003113274 407 LTAGYGVLHWIHPTQ--GYWILLTTVFVCQPNYGATRLRLVQRILGTVVGLVG-GWALIDLFPSPLV-QSLFAVAAGVAF 482 Pseudomonas aer...
P44289       469 FFFRSNNYSFSTFFITLQVLLSFDVMGfDTAAALMPRLLDTLLGAAISWFAVSYLWPDWKYLQLDKVSHQALRSDAVYLL 548 Haemophilus inf...
P75870       477 FAFRNVQYAHATMFITLLVLLCFNLLG-EGFEVALPRVIDTLIGCAIAWAAVSYIWPDWQFRNLPRMLERATEANCRYLD 555 Escherichia col...
P45537       454 YLILRKNYGWATVGFTITAVYTLQLLWlNGEQYILPRLIDTIIGCLIAFGGTVWLWPQWQSGLLRKNAHDALEAYQEAIR 533 Escherichia col...
WP_003113274 483 FATRSSRYTLATAAITLLVLFCFNQVG-DGYGLILPRLFDTLLGSLIAGLAVFLVLPDWQGRRLNRMLANTLACNSRYLR 561 Pseudomonas aer...
P44289       549 HIISQLQFGKSDDLKYRIARRN-AHQYAAALSTTLSNMNNEPVKYKAYLQKGFDLLKLNYSLLSYISALG--AYRDRMKN 625 Haemophilus inf...
P75870       556 AILEQYHQGRDNRLAYRIARRD-AHNRDAELASVVSNMSSEPNVTPQIREAAFRLLCLNHTFTSYISALG--AHREQLTN 632 Escherichia col...
P45537       534 LILSEDPQ--PTPLAWQRMRVNqAHNT---LYNSLNQAMQEPAFNSHYLADMKLWVTHSQFIVEHINAMTtlAREHRALP 608 Escherichia col...
WP_003113274 562 QIMQQYATGKRDDLDYRTARRN-AHNADAALSTTLSNMLLEPGHFRKDAEIGFRFLVLSHTLLSYLSGLG--AHRESLPE 638 Pseudomonas aer...
P44289       626 LQQTAQFLSGFYPVAKKIIYTLEHIEeipe-aifnQQQESIEThlKELEKQEMTAEERAVFSLPYQQLNLITQLLPQFYG 704 Haemophilus inf...
P75870       633 PEILAFLDDAVCYVDDALHHQPADEE---------RVNEALAS--LKQRMQQLEPRADSKEPLVVQQVGLLIALLPEIGR 701 Escherichia col...
P45537       609 PELAQEYLQSCEI---AIQRCQQRLE---------YDEPGSSGdaNIMDAPEMQPHEGAAGTLE-QHLQRVIGHLNTMHT 675 Escherichia col...
WP_003113274 639 DASDGLLERAAERLSASLEEIAASLEqkrpvaiysEEEEALAK-----ELEQMPEDMDDSHRLVQTQLAHICRQLAPLRT 713 Pseudomonas aer...
P44289       705 YFKKE 709 Haemophilus influenzae Rd KW20
P75870       702 LQRQI 706 Escherichia coli K-12
P45537       676 ISSMA 680 Escherichia coli K-12
WP_003113274 714 LAAHL 718 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap