Conserved Protein Domain Family
YCCS

?
TIGR01666: YCCS 
TIGR01666 family membrane protein
This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other]
Statistics
?
PSSM-Id: 130727
View PSSM: TIGR01666
Aligned: 3 rows
Threshold Bit Score: 1164.62
Threshold Setting Gi: 1176248
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44289         2 NIRLNAKVISTIPVFIAVNIAAVGIWFFDISSQSMPLILGIIAGGLVDLDNRLTGRLKNVFFTLIAFSISSFIVQLHIGK 81  Haemophilus inf...
P75870         8 RYTWNSAWLYYARIFIALCGTTAFPWWLGDVKLTIPLTLGMVAAALTDLDDRLAGRLRNLIITLFCFFIASASVELLFPW 87  Escherichia col...
WP_001882559  13 LYWANKTVNYSVLILLTLLGVVIPAWYYQLNTWITPLILGVIAAALADRDDRFSGRLKSIILTLICFAIAAFSIEILFQT 92  Vibrio cholerae
P44289        82 PIQYIVLMTVLTFIFTMIGAVGQRYSTIAFGSLVVALYTTLTYIpEVNVWFINPVMILCGTLLYSVVTLIVYLFFPNRPV 161 Haemophilus inf...
P75870        88 PWLFAIGLTLSTSGFILLGGLGQRYATIAFGALLIAIYTMLGTS-LYEHWYQQPMYLLAGAVWYNVLTLIGHLLFPVRPL 166 Escherichia col...
WP_001882559  93 PWLFALGLFTSSFGFIMLGAMGARYASIAFASLLVAVYTMLGAH-QSTNIWFQPLLLLSGSAWYYLMSMLWHAFWPMQPV 171 Vibrio cholerae
P44289       162 QESVAKAFCALGEYLDTKSCFFDPDEVAEIEKKHLNFAMKNANVVTAFNIVRTALFYRIRGQHRHPLTQRMLRYYFAAQD 241 Haemophilus inf...
P75870       167 QDNLARCYEQLARYLELKSRMFDPDIEDQSQAPLYDLALANGLLMATLNQTKLSLLTRLRGDRGQRGTRRTLHYYFVAQD 246 Escherichia col...
WP_001882559 172 QQNLANVFLQLANYLEAKSTLFHPVSNMIPQPHRIIEANLNAATVNALNQCKAVFLTRSKRGHVDSASDRFLNIYFLAQD 251 Vibrio cholerae
P44289       242 IHERANSTHFDYQQITEKLKNTDLIFRIQRLLELQAQSCKEITASLRENKPYHFNKRVERALLGTLHSFDLYRa-QHLND 320 Haemophilus inf...
P75870       247 IHERASSSHIQYQTLREHFRHSDVLFRFQRLMSMQGQACQQLSRCILLRQPYQHDPHFERAFTHIDAALERMR--DNGAP 324 Escherichia col...
WP_001882559 252 IHERVSSSHYRYQELADHFGRSDILFRFKYLLETQAKACRDIAQSIRLGHSYQHDSASIVALDELQLSLSYLRqqERRDW 331 Vibrio cholerae
P44289       321 QDELIDIQTLLDNLQSINWQLRQLAQDTTVTEQL----AQIHTEQITGLKNISAVIFSHFTFESPLFRHAVRLSIVVFLC 396 Haemophilus inf...
P75870       325 ADLLKTLGFLLNNLRAIDAQLATIESEQAQALPHnndeNELADDSPHGLSDIWLRLSRHFTPESALFRHAVRMSLVLCFG 404 Escherichia col...
WP_001882559 332 KSLLGQLGYLFNNLATVEKQLNNVSNPDVAKPEe----GVLDDTEAHTLGSMWQRIRANLNKDSLLFRHALRLSITLTLG 407 Vibrio cholerae
P44289       397 CAIVEFFQFNLGYWILLTTVFVCQPNYSATKVRLRQRIIGTILGVVVGSLLPYLNPTLELKLGLVVLTSTLFFFFRSNNY 476 Haemophilus inf...
P75870       405 YAIIQITGMHHGYWILLTSLFVCQPNYNATRHRLKLRIIGTLVGIAIGIPVLWFVPSLEGQLVLLVITGVLFFAFRNVQY 484 Escherichia col...
WP_001882559 408 YAIIQGFGIERGYWILLTTLFVCQPNYAATKQKLTARIIGTLAGLLIGVPLLTFFPSQESQLVFIVFSGVMFFAFRLNNY 487 Vibrio cholerae
P44289       477 SFSTFFITLQVLLSFDVMGfDTAAALMPRLLDTLLGAAISWFAVSYLWPDWKYLQLDKVSHQALRSDAVYLLHIISQLQF 556 Haemophilus inf...
P75870       485 AHATMFITLLVLLCFNLLG-EGFEVALPRVIDTLIGCAIAWAAVSYIWPDWQFRNLPRMLERATEANCRYLDAILEQYHQ 563 Escherichia col...
WP_001882559 488 GYATGFITLLVLFCFNQLG-EGYAVVLPRLADTLIGCALAVAAVVLILPDWQSKRLHKVMAEAIDANKQYLAQIIGQYRI 566 Vibrio cholerae
P44289       557 GKSDDLKYRIARRNAHQYAAALSTTLSNMNNEPVKYKAYLQKGFDLLKLNYSLLSYISALGAYRDRMKNLQQTAQFLSGF 636 Haemophilus inf...
P75870       564 GRDNRLAYRIARRDAHNRDAELASVVSNMSSEPNVTPQIREAAFRLLCLNHTFTSYISALGAHREQLTNPEILAFLDDAV 643 Escherichia col...
WP_001882559 567 GKKDSLSYRIARRHAHNQDAALSAAVTNMLAEPGRYRAAADESFRFLTLNHALLSYISALGAHRTRLDDETVHQLVLDSH 646 Vibrio cholerae
P44289       637 YPVAKKIIYTLEHIEeipeaifnQQQESIEThlKELEKQEMTAEERAVFSLPYQQLNLITQLLPQFYGYFKKE 709 Haemophilus influenzae...
P75870       644 CYVDDALHHQPADEE--------RVNEALAS--LKQRMQQLEPRADSKEPLVVQQVGLLIALLPEIGRLQRQI 706 Escherichia coli K-12
WP_001882559 647 RVIHQHLDLLHQQLSnhceecdtSGID-SSG--LEKRLAEWREDDEGSARMVLQQLHLIYRMLPELHTLASKF 716 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap