Conserved Protein Domain Family
yxeA_fam

?
TIGR01655: yxeA_fam 
conserved hypothetical protein TIGR01655
This model represents a family of small (about 115 amino acids) uncharacterized proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 130716
View PSSM: TIGR01655
Aligned: 5 rows
Threshold Bit Score: 117.209
Threshold Setting Gi: 446796674
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB86323       4 YKLYHLNMIATIIGVIIFSAFIIGYHYSG-VDYYIKIDNPSKISPINFPISNTLlisYEYKGIARDSSGKPRQMKFntiq 82  Lactobacillus a...
P54940         1 MKKAMAILAVLAAAAVICGLLFFHNDVTDrFNPFIHQQDVYVQIDRDGRHLSPGg--TEYTLDGYNASGKKEEVTF---- 74  Bacillus subtil...
AAK04681       1 MKKVLVGLLAIMVMIIASGYTYYKMNYGG-ESYYVQILVNGEREETTADDHTPMv-iYHYKLDSFNSKGDKKLVKF---- 74  Lactococcus lac...
WP_000873930   1 MKYIIAILLGLIVSITIAFTIIHHP-ILDrFNPFLKTEYSYAKVPKGTQQYVN--------ITAYSERGEKLDYKL---- 67  Staphylococcus ...
WP_003764048   1 MKKGLFGLLAAIFVLTMVVIEFSAPVGSAaNTYYVTIKNDGKEVTKSKFKGYS------FRESCLDNQGNSHKVNF---- 70  Listeria innocua
BAB86323      83 IKGTNLKSGEIIRLTYnKYYGVVRYKQISRKSVPKKARLKG 123 Lactobacillus acidophilus
P54940        75 FAGKELRKNAYLKVKA-KGKYVETWEEVKFEDMPDSVQSKL 114 Bacillus subtilis subsp. subtilis str. 168
AAK04681      75 MASHNLRNQAYLELTYnKHKGVTNWNEVQEKEIPKPALKEL 115 Lactococcus lactis subsp. lactis Il1403
WP_000873930  68 TFNGFSPSRTYVEIKH-KGQYVISITYVEKEDTPKEVRQE- 106 Staphylococcus aureus
WP_003764048  71 MSTTQLKKNKQYKIVVqDNELLVQAKEI--NSVPLASSK-- 107 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap