Conserved Protein Domain Family

TIGR01655: yxeA_fam 
conserved hypothetical protein TIGR01655
This model represents a family of small (about 115 amino acids) uncharacterized proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members. [Hypothetical proteins, Conserved]
PSSM-Id: 130716
Aligned: 5 rows
Threshold Bit Score: 117.209
Threshold Setting Gi: 446796674
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
BAB86323      83 IKGTNLKSGEIIRLTYnKYYGVVRYKQISRKSVPKKARLKG 123 Lactobacillus acidophilus
P54940        75 FAGKELRKNAYLKVKA-KGKYVETWEEVKFEDMPDSVQSKL 114 Bacillus subtilis subsp. subtilis str. 168
AAK04681      75 MASHNLRNQAYLELTYnKHKGVTNWNEVQEKEIPKPALKEL 115 Lactococcus lactis subsp. lactis Il1403
WP_000873930  68 TFNGFSPSRTYVEIKH-KGQYVISITYVEKEDTPKEVRQE- 106 Staphylococcus aureus
WP_003764048  71 MSTTQLKKNKQYKIVVqDNELLVQAKEI--NSVPLASSK-- 107 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap