Conserved Protein Domain Family
CobT

?
TIGR01651: CobT 
cobaltochelatase, CobT subunit
This model describes Pseudomonas denitrificans CobT gene product, which is a cobalt chelatase subunit that functions in cobalamin biosynthesis. Cobalamin (vitamin B12) can be synthesized via several pathways, including an aerobic pathway (found in Pseudomonas denitrificans) and an anaerobic pathway (found in P. shermanii and Salmonella typhimurium). These pathways differ in the point of cobalt insertion during corrin ring formation. There are apparently a number of variations on these two pathways, where the major differences seem to be concerned with the process of ring contraction. Confusion regarding the functions of enzymes found in the aerobic vs. anaerobic pathways has arisen because nonhomologous genes in these different pathways were given the same gene symbols. Thus, cobT in the aerobic pathway (P. denitrificans) is not a homolog of cobT in the anaerobic pathway (S. typhimurium). It should be noted that E. coli synthesizes cobalamin only when it is supplied with the precursor cobinamide, which is a complex intermediate. Additionally, all E. coli cobalamin synthesis genes (cobU, cobS and cobT) were named after their Salmonella typhimurium homologs which function in the anaerobic cobalamin synthesis pathway. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobT gene product, which is a cobalt chelatase subunit, with a MW ~70 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobS (TIGR01650) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobT gene product, the P. denitrificans gene symbol is not used in the name of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 130712
View PSSM: TIGR01651
Aligned: 3 rows
Threshold Bit Score: 1019.87
Threshold Setting Gi: 499221018
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P29934        17 EPFKRALSGCIRSIAGDAEVEVAFANERPGMTGERIRLPELSKRPTLQELAVTRGLGDSMALRKACTHARIQRTMSPQGA 96  Pseudomonas den...
WP_010911773  19 DSFKRAVTVCMRAIAGDKDMEVGFAKDRPALAGSRARLPELPKKASKTDIAITRGLGDSMALKRACHDARIHSKLAPEGK 98  Mesorhizobium loti
WP_010918558  10 EPFKRALAHAARSLAETPDLEVVFSGDGPQLLGNRAVLPHPPRDLSSREAARIRGLADQMALRLAHHDPLAHARARPSSP 89  Caulobacter vib...
P29934        97 DARAIFDAVEQARVEAIGSLRMAGVAKNLNVMLEEKYAKANFA--TIERQADAPLGEAVALLVREKLTGQKPPASAGKVL 174 Pseudomonas den...
WP_010911773  99 AARAIYDAVEQARVEAIGSRAMQGVADNIGSMLEDKYAKANLV--DVKDKADAPIEEALALMVREKLTGRAVPKSGERLV 176 Mesorhizobium loti
WP_010918558  90 DGQAAFESIEQARLEAIGANALGGVRANLTAALEARLEKQGLTraVATDRQSAPMAEILGLMVRERLTGDAPPHGAKALV 169 Caulobacter vib...
P29934       175 DLWREFIEGKAAGDIEHLSSTINNQQAFARVVRDMLTSMEVAEKYGDDdnEPDEQESETDEDQPRSQEQDENASDEEAGD 254 Pseudomonas den...
WP_010911773 177 ELWRPWVEEKAKADLDGLSAKLDDQQAFARVVREMLASMEMAEELGDD--QETEDSEDNDDNQPQGDEQSEEGGEEDSGS 254 Mesorhizobium loti
WP_010918558 170 DILRNDIEARAGKDLDRLAAAIDDQAAFARVTREILRDLDLSEEMADA--TESADEEDGEDDAPTENSDEDQGEGEGEQQ 247 Caulobacter vib...
P29934       255 DAAPADENQAAEEQMEEGEMDGAEISDDDLQDEGDEDSETPGEVKRPNQPFADFN--EKVDYAVFTREFDETIASEELCD 332 Pseudomonas den...
WP_010911773 255 EQSQSEDAEASADDEQSSETEASDATADDLSDDDDADAETPGEARRNDNPFTNLP--KEIDYKVFTSAFDETVGAEELCE 332 Mesorhizobium loti
WP_010918558 248 EGSAPQESEATDRESESGDEEMVQSDQEGEPEES-DESPEMGDGAKPARPDTSTGqgGEPQYKIFTTAHDEIVDAEDLCD 326 Caulobacter vib...
P29934       333 EAELDRLRAFLDKQLAHLQGAVGRLANRLQRRLMAQQNRSWEFDLEEGYLDSARLQRIIIDPMQPLSFKREKDTNFRDTV 412 Pseudomonas den...
WP_010911773 333 EEELDRLRAFLDKQLANLSGVVGRLANRLQRRLMAQQNRSWDFDLEEGYLDPARLVRVVIDPMQPLSFKQERDTKFRDTV 412 Mesorhizobium loti
WP_010918558 327 AEELTRLRAYLDQQLTALSSVVSRLANKLQRRLLAQQNRSWTFDLEEGMLDVARLTRVIIDPTAPLSFKQEEDQEFRDTV 406 Caulobacter vib...
P29934       413 VTLLIDNSGSMRGRPITVAATCADILARTLERCGVKVEILGFTTKAWKGGQSREKWLAGGKPQAPGRLNDLRHIVYKSAD 492 Pseudomonas den...
WP_010911773 413 VTLVLDNSGSMRGRPITVAATCADILARTLERCGVSVEILGFTTRAWKGGQAREKWLKDGKPPNPGRLNDLRHIIYKSAD 492 Mesorhizobium loti
WP_010918558 407 VTLLIDNSGSMRGRPIMVAAICADILARTLERCGVKTEVLGFTTRAWKGGTSRDEWIKAGKPAAPGRLNDLRHIIYKAAD 486 Caulobacter vib...
P29934       493 APWRRARRNLGLMMREGLLKENIDGEALIWAHERLMARREQRRILMMISDGAPVDDSTLSVNPGNYLERHLRAVIEQIET 572 Pseudomonas den...
WP_010911773 493 HPWRRARRNLGLMMREGLLKENIDGEALLWAHNRLIARPEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRAVIELIET 572 Mesorhizobium loti
WP_010918558 487 APWRRARKNLGLMMREGLLKENIDGEALMWAHQRIIARPEQRRILMVISDGAPVDDSTLSVNSGHYLERHLRQVITEIEG 566 Caulobacter vib...
P29934       573 RSPVELLAIGIGHDVTRYYRRAVTIVDADELAGAMTEQLAALFEDE 618 Pseudomonas denitrificans
WP_010911773 573 RSPVELLAIGIGHDVTRYYRRAVTIVDAEELAGAMTEQLASLFAEE 618 Mesorhizobium loti
WP_010918558 567 KSPVELIAIGIGHDVTRYYRRAVTIVDVEQLGGVLVEQLAALFEEE 612 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap