Conserved Protein Domain Family
PD_CobS

?
TIGR01650: PD_CobS 
cobaltochelatase, CobS subunit
This model describes Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit that functions in cobalamin biosynthesis. Cobalamin (vitamin B12) can be synthesized via several pathways, including an aerobic pathway (found in Pseudomonas denitrificans) and an anaerobic pathway (found in P. shermanii and Salmonella typhimurium). These pathways differ in the point of cobalt insertion during corrin ring formation. There are apparently a number of variations on these two pathways, where the major differences seem to be concerned with the process of ring contraction. Confusion regarding the functions of enzymes found in the aerobic vs. anaerobic pathways has arisen because nonhomologous genes in these different pathways were given the same gene symbols. Thus, cobS in the aerobic pathway (P. denitrificans) is not a homolog of cobS in the anaerobic pathway (S. typhimurium). It should be noted that E. coli synthesizes cobalamin only when it is supplied with the precursor cobinamide, which is a complex intermediate. Additionally, all E. coli cobalamin synthesis genes (cobU, cobS and cobT) were named after their Salmonella typhimurium homologs which function in the anaerobic cobalamin synthesis pathway. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 130711
View PSSM: TIGR01650
Aligned: 2 rows
Threshold Bit Score: 714.102
Threshold Setting Gi: 499214235
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010920857   8 SSAADPLITLVPDRWVTLRDAFGVDSDMKVPAFSHRDSHVPDIDPAYRFDPQTTKAICAGFAYDRRVMVQGYHGTGKSTH 87  Caulobacter vib...
WP_010911775  37 MNKVDRDIANLPDTTVSVKDKFGFDSKMVVPAYSVTSEHVPDVDPDYLFDKATTLAILAGFAYNRRVMVSGYHGTGKSTH 116 Mesorhizobium loti
WP_010920857  88 IEQIAARLNWPLVRVNLDSHVSRIDLVGKDAIVLKDGKQITEFREGILPWTLQRPVALVFDEYDAGRPDVMFVIQRVLEA 167 Caulobacter vib...
WP_010911775 117 IEQVAARLNWPCVRVNLDSHVSRIDLVGKDAIVVKDGLQITEFRDGILPWAYQHNVALCFDEYDAGRPDVMFVIQRVLES 196 Mesorhizobium loti
WP_010920857 168 GGKLTLLDQNRVIRANPYFRLFATTNTIGLGDTTGLYHGTQQINQGQMDRWSIVTTLNYLEHDVEAAIVLAKNPGFDSVE 247 Caulobacter vib...
WP_010911775 197 SGRLTLLDQSRVIRPHPAFRLFSTANTVGLGDTTGLYHGTQQINQAQMDRWSIVTTLNYLPHDNEVNIVLAKAKHYRDTK 276 Mesorhizobium loti
WP_010920857 248 GKRTISAMVRVADMTRNAFMNGDISTVMSPRTVITWAQNAEIFDhDVALAFRLTFLNKCDELERPTVAEFFQRAFGTDLP 327 Caulobacter vib...
WP_010911775 277 GKDIVNKMVRVADMTRSAFINGDLSTVMSPRTVITWAENAEIFG-NIGMAFRLTFLNKCDELERSVVAEFYQRAFGEDLP 355 Mesorhizobium loti
WP_010920857 328 ESAARVK 334 Caulobacter vibrioides
WP_010911775 356 ESAANVV 362 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap