4JLE


Conserved Protein Domain Family
P_fal_TIGR01639

?
TIGR01639: P_fal_TIGR01639 
Click on image for an interactive view with Cn3D
Plasmodium falciparum uncharacterized domain TIGR01639
This model represents a conserved sequence region of about 60 amino acids found in over 40 predicted proteins of Plasmodium falciparum. It is not found elsewhere, including closely related species such as Plasmodium yoelii. No member of this family is characterized.
Statistics
?
PSSM-Id: 130700
View PSSM: TIGR01639
Aligned: 15 rows
Threshold Bit Score: 55.724
Threshold Setting Gi: 583211546
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4JLE_A        11 INKCDM-KKYTAEEINEMINSSNEFINRND--MNIIFSYVHESEREKFKKVEENIFKFIQSI 69  Plasmodium falciparum 3D7
CDO63760     732 KKFFDLnHEITEEDLTEMVRSLDNIPSIND--ILHIWWQLREVERHKFAMMQYRLMKYIGHL 791 Plasmodium reichenowi
ETW44915     152 QDYNDVnKKFTKEQMKNLVNSLDEIPPRND--MEKIWNHAVKTANSGTSRIKKKLKEYEQKY 211 Plasmodium falciparum NF135/5.C10
ETW49350     151 DKYYDLtKQWSDEKIEEIINSLLDIPNKFD--VLTIWMQVRGSEKLKMHNMLYGLRLLYKEL 210 Plasmodium falciparum MaliPS096_E11
EWC75015      98 VDYNDLsRNLSREELNAVLRGLNDDTPRND--LISIWNHVVRINRDGMVDIINSILLYVNNF 157 Plasmodium falciparum UGT5.1
ETW34278     164 YEYSELaDSMTDEEIDKEVDKLMEYTNNNKekVYSLWWQIMRNERVKYVMIMKNLYNFFLKL 225 Plasmodium falciparum Tanzania (2...
XP_002585404 147 LIFGDTsPDLSESEFNEFINNLDDYVNKNE--MYIIWNYVNSKEKFKYLNMQQNIKSYCENL 206 Plasmodium falciparum 3D7
EUR62147     146 KKCTDLsAFESKEDIYILLCSLSEIPKKCE--ILGIWYQAIYIARN-SSKMQEHLKEYMCCH 204 Plasmodium falciparum 7G8
ETW60009      10 HNNNFIsKQLTKEELYDLLYTLVEVPERKI--LLLLWNQTIGLYNEQLEDLLKEIYNFLPNR 69  Plasmodium falciparum CAMP/Malaysia
EWC73426     172 IKLEEIsLPLSKLELSHIISRLNKDVPKEY--LMNLWLQAFAVSND-LVDIVNLLNEYIQYY 230 Plasmodium falciparum UGT5.1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap