Conserved Protein Domain Family
phage_rinA

?
TIGR01636: phage_rinA 
phage transcriptional activator, RinA family
This model represents a family of phage proteins, including RinA, a transcriptional activator in staphylococcal phage phi 11. This family shows similarity to ArpU, a phage-related putative autolysin regulator, and to some sporulation-specific sigma factors. [Mobile and extrachromosomal element functions, Prophage functions, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130697
View PSSM: TIGR01636
Aligned: 3 rows
Threshold Bit Score: 183.566
Threshold Setting Gi: 489827893
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q03182         8 LKLSTVRKLEDELCDYPNYHKQLEDLRSEIMTP---WIPTDTNIGGEFVPSNTSKTEMAVTNYLCSIRRGKILEFKSAIE 84  Staphylococcus ...
WP_002379371   1 MRTSTFNYIKDILADFYKTEEYIRQREEELRHP---YQEADLNAGIRGQGLHSVVTERMAITIAMDRRLWNLERNRDIIK 77  Enterococcus fa...
WP_003731654   5 LRKAQYKLIEDELKFYHSTKKELMEKEVNVTLGawhREYIDENQGGGSAGNISNEVEDRVMLLQMDKEISRLKNIINAIE 84  Listeria
Q03182        85 RIINSSSRKEREFIQEYYFNKK---ELVKVCVDIHISDRTAHRIKRKIISRLAEELGE 139 Staphylococcus phage 11
WP_002379371  78 NCLAEADEQTRVIIEELYMKKRpslTLIGLAQQLFISKSQAYKLRNHFFEAVADELGM 135 Enterococcus faecalis
WP_003731654  85 SVLNRLNDEDKQLIQFRYWDRSk-pTWVWIASKLNMDESTARRRNKTIILSIAERLGY 141 Listeria
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap