Conserved Protein Domain Family
tail_comp_S

?
TIGR01635: tail_comp_S 
phage virion morphogenesis (putative tail completion) protein
This model describes protein S of phage P2, suggested experimentally to act in tail completion and stable head joining, and related proteins from a number of phage. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130696
View PSSM: TIGR01635
Aligned: 6 rows
Threshold Bit Score: 141.927
Threshold Setting Gi: 17865414
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC34159   2 SELTALQERLAGLIASLSPAARRKMAAEIAKKLRTSQQQRIKRQQAPD-GTPYAARKr--QPVRSKKGRIkR-EMFAKLR 77  Enterobacteria phag...
AAC45165   2 DEMLQVKTAFERLLKNVSPKRLRLLYQQIGRELARSQRKRIKAQQNPD-GSAYQPRK---QKVRSKKGRIkTqAMFKKIT 77  Histophilus somni
AAL47521   7 EDRSYLRVMEQLELLGLDRKTRDKMLRRIGAQIAKTTRKNIRAQRDPD-GSAWAKR---------KRGRG---KLLKGFT 73  Vibrio phage K139
P45255     7 NNAQEITSALERLAQATA--HRAPLMRSIAGTMESAVAQNFEVGGRPAw-----------KKLKIRQGTP-----LVDTE 68  Haemophilus influen...
Q01261     9 VDVRRIQLALDELGTVTR--DRA-IPRVMAAALLSSTEQAFERQADPDtGKGWEAWSdswLAWRQDHGFVpG-SILTLHG 84  Enterobacteria phag...
O05072     7 FDTSTIQQKFKKLAQVMD--GRD-ITRKVAGVLRQEAEKFFDLEQAPT-GEKWEDLDedyKKYRYAAGHT-G-KILQIRG 80  Haemophilus influen...
AAC34159  78 TSRFMKAKGSDSAAVVEFTGKVQRMARVHQYGLKDRPNRn-SRDVQYEARPLLGFTRDDEQMIEDVIISHLG 148 Enterobacteria phage 186
AAC45165  78 QARHMKLRRQKDGIELGFSGNTAYIATIHQYGLRARVERhkEHKVQYAKRELLGFTEQDKEMIEAFVIKALS 149 Histophilus somni
AAL47521  74 QKLKHFQRDNNRTLVVGWPSARGRVAYEHHHGIAQESG---LSARKRQAKQQNEPRKTDPATREQAKRCAIS 142 Vibrio phage K139
P45255    69 --NLMASITSEYNNNEAIVGTNEPYAAIHQFGGKAG-RG---RKVAIPARPFLILTPQDEADILEDIQDYFQ 134 Haemophilus influenzae Rd KW20
Q01261    85 --DLARSITTDYGQDYALIGSPKIYAAIHQWGGTPDMAP---RPAGVPARPYMGLDKTGEQEIFDAIRKRVS 151 Enterobacteria phage Mu
O05072    81 GRGLAGSLSLDYGDNYALIGAAEEYGGFHQLG-----------TTFMPARPFLGLGKDGVSEIKAILNRELS 141 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap