Conserved Protein Domain Family
tail_P2_I

?
TIGR01634: tail_P2_I 
phage tail protein, P2 protein I family
This model represents the family of phage P2 protein I and related tail proteins from a number of temperate phage of Gram-negative bacteria. This model is built as a fragment model and identifies some phage tail proteins with strong but local similarity to members of the seed alignment. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130695
View PSSM: TIGR01634
Aligned: 4 rows
Threshold Bit Score: 233.23
Threshold Setting Gi: 4063792
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC34163       7 LPVGSSPLEVAAARACADIENTPVPLRRLWSPDTCPANLLPWLAWAFSVDRWDENWPEKTKRDVIRSAYFTHCHKGTIGA 86  Enterobacteria ...
BAA36246       5 LPRNATELERLAAEALAQIERVPIPLRQLWNPSTCPVALLPYLAWAFSVDRWDSTWPERVKRQVIRDAYLVHSHKGTLSA 84  Pseudomonas pha...
WP_010893249   9 LPPTATPLMRTLEQVMARLADIPIPFKQLWDPHTCPEPLLPWLAWSLSVDTWRSTWPVHIKRARIAAAIEIQRCKGSVKS 88  Xylella fastidiosa
WP_005929475   5 LPPNATPIERALAAVTARLEAIPLPYPDLWNPDTCPAGHLPWLAWTLSVDDWKADWSDAVKRSRLRSAMAIQRRKGTANS 84  Xanthomonas axo...
AAC34163      87 VRRVIEPLGYIINVTEWWETG--DPAGTFRLDIGVLESGITEEMYLEMERLIADAKPAS 143 Enterobacteria phage 186
BAA36246      85 LRRVVEPVGSLTDILEWWQQTpaGVPGTFEITVDVSDNGLDEETVLELERLLDDVRPVS 143 Pseudomonas phage phiCTX
WP_010893249  89 VRDVVRSFGGDVLITEWWQQNppAAPHTFTLLLTLSGQGGSQTTAEFVADVITEVIRTK 147 Xylella fastidiosa
WP_005929475  85 VRMVVESFGGAVAIREWWQTEprGQPHTFELTLTLTGTDGQTATSRFVNEVIAEVERTK 143 Xanthomonas axonopodis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap