Conserved Protein Domain Family
PABP-1234

?
TIGR01628: PABP-1234 
polyadenylate binding protein, human types 1, 2, 3, 4 family
These eukaryotic proteins recognize the poly-A of mRNA and consists of four tandem RNA recognition domains at the N-terminus (rrm: pfam00076) followed by a PABP-specific domain (pfam00658) at the C-terminus. The protein is involved in the transport of mRNA's from the nucleus to the cytoplasm. There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed and of unknown tissue range.
Statistics
?
PSSM-Id: 130689
View PSSM: TIGR01628
Aligned: 6 rows
Threshold Bit Score: 688.081
Threshold Setting Gi: 124806145
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O64380        49 SSLYAGDLDPKVTEAHLFDLFKHVANVVSVRVCRDQN-RRSLGYAYINFSNPNDAYRAMEALNYTPLFDRPIRIMLSNRD 127 thale cress
Q13310        11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMItRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRD 90  human
Q9ZQA8        24 ASLYVGDLHPSVTEGILYDAFAEFKSLTSVRLCKDASsGRSLCYGYANFLSRQDANLAIEKKNNSLLNGKMIRVMWSVRA 103 thale cress
AAF70533      25 ASIYVGDLDATINEPQLVELFKPFGTILNVRVCRDIItQRSLGYGYVNFDNHDSAEKAIESMNFKRVGDKCVRLMWQQRD 104 Leishmania major
AAC02537       9 PSIWVGGLDPNLNEQKLYDHFVRLGPVASVRVCVDSVtQKSLGYGYVNFQNPADAEKALDQAGVK-LGSKHIRIAKIQRD 87  Trypanosoma cruzi
XP_001350640  16 ASLYVGDLNEDVTEAVLYEIFNTVGHVSSIRVCRDSVtRKSLGYAYVNYHNLADAERALDTLNYTNIKGQPARLMWSHRD 95  Plasmodium falc...
O64380       128 PSTRLSGKGNIFIKNLDASIDNKALFETFSSFGTILSCKVAMDVTGrSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVF 207 thale cress
Q13310        91 PSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVF 169 human
Q9ZQA8       104 PDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCKVATLEDGkSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIY 183 thale cress
AAF70533     105 PALRYSGNGNVFVKNLEKDVDSKSLHDIFTKFGSILSCKVMQDEEGkSRGYGFVHFKDETSAKDAIVKMNGAADHASEDK 184 Leishmania major
AAC02537      88 PSKRRSGVTNIVVKKLPPSVDTYALKEMFSKYGRLTAIGLATNENGeSRGYARISYEKEESAIQAVQEVNGMVIDDCAIT 167 Trypanosoma cruzi
XP_001350640  96 PSLRKSGTGNIFVKNLDKSIDNKALFDTFSMFGNILSCKVATDEFGkSKSYGFVHYEDEESAKEAIEKVNGVQLGSKNVY 175 Plasmodium falc...
O64380       208 VGHFIRRQERar-deNTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGNSrcFGFVNFECTEAAASAV 286 thale cress
Q13310       170 VGRFKSRKERea-elGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSkgFGFVSYEKHEDANKAV 248 human
Q9ZQA8       184 VGKFMKKTDR-----VKPEEKYTNLYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDENRLCrgYAFVNFDNPEDARRAA 258 thale cress
AAF70533     185 KALYVANFIRrnarlAALVANFTNVYIKQVLPTVNKDVIEKFFAKFGGITSAAACKDKSGRv--FAFCNFEKHDDAVKAV 262 Leishmania major
AAC02537     168 VERYQPHHREe------QLKQFTNLYVKNLDPSVNDEKLKEVFSAFGEVTSAKVRDLGANQTvgFAYVAYATHEAAAKAV 241 Trypanosoma cruzi
XP_001350640 176 VGPFIKKSER-----ATNDTKFTNLYVKNFPDSVTETHLRQLFNPYGEITSMIVKMDNKNRK--FCFINYADAESAKNAM 248 Plasmodium falc...
O64380       287 EKMNGISLG----------------------------------------------------------------------- 295 thale cress
Q13310       249 EEMNGKEIS----------------------------------------------------------------------- 257 human
Q9ZQA8       259 ETVNGTKFG----------------------------------------------------------------------- 267 thale cress
AAF70533     263 EAMHDHHIDgit-------------------------------------------------------------------- 274 Leishmania major
AAC02537     242 EELDEKESPla--------------------------------------------------------------------- 252 Trypanosoma cruzi
XP_001350640 249 DNLNGKKITddgqidetydpkkeeatastsgaanqttgtdadktdkndknnkadknekgdssnannnatatgatttdttt 328 Plasmodium falc...
O64380           --------------------------------------------------------------------------------     thale cress
Q13310           --------------------------------------------------------------------------------     human
Q9ZQA8           --------------------------------------------------------------------------------     thale cress
AAF70533         --------------------------------------------------------------------------------     Leishmania major
AAC02537         --------------------------------------------------------------------------------     Trypanosoma cruzi
XP_001350640 329 tpgetttttanadstgannnnglspntntsntttgssnnsinlnennntagnnnstnnnnnsgssmnnagsakkdetaas 408 Plasmodium falc...
O64380       296 -----DDVLYVGRAQKKSEREEELRRKFEQERINRFEKSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLN-PqG 369 thale cress
Q13310       258 -----GKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-D-G 330 human
Q9ZQA8       268 -----SKCLYVGRAQKKAEREQLLREQFKEKHEEQKMIAKVSNIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCD-EkG 341 thale cress
AAF70533     275 ---apGEKLYVQRAQPRSER---LIALRQKYMQH---QALGNNLYVRNFDPEFTGADLLELFKEYGEVKSCRVMVS-EsG 344 Leishmania major
AAC02537     253 ---keGMKLSVCRFRSRDERQRERERLRRERQQQ---HSKYPNLYVKNFDDTVTSERLKELFERCGETVSVSVMMDrAtR 326 Trypanosoma cruzi
XP_001350640 409 dcadtPNILYVGPHQSRARRHAILKAKFDNLNVENKNKHQGVNLYIKNLDDGIDDIMLRELFEPFGTITSAKVMRD-EkE 487 Plasmodium falc...
O64380       370 MSRGFGFVAYSNPEEALRALSEMNG-KMIGRKPLYIALAQRKEDRRAHLQALF----------------SQ-IRAPG--- 428 thale cress
Q13310       331 RSKGFGFVCFSSPEEATKAVTEMNG-RIVGSKPLYVALAQRKEERKAHLTNQY----------------MQ-RVAGMral 392 human
Q9ZQA8       342 KSKGFGFVCFSTPEEAIDAVKTFHG-QMFHGKPLYVAIAQKKEDRKMQLQVQFg------------------NRVEArks 402 thale cress
AAF70533     345 VSRGFGFVSFSNADEANAALREMNG-RMLNGKPLIVNIAQRRDQRYTMLRLQF----------------QQrLQMMMrqm 407 Leishmania major
AAC02537     327 VSRCFGFVSFKEQSAASRAIQELHGsTALGPRPLFVTYALRKDARRQTLEDMR----------------NK--QPRMrqp 388 Trypanosoma cruzi
XP_001350640 488 QSKGFGFVCFASQEEANKAVTEMHL-KIINGKPLYVGLAEKREQRLSRLQQRFrmhpirhhmnnplntpMQyASPQSpql 566 Plasmodium falc...
O64380       429 -----------PMSGFHhp----pGgpmpgppQHMYVG-QNGASMVPSQPiGYG------FQPQFMPGMRPG-------- 478 thale cress
Q13310       393 pa----nailnQFQPAAggy-fvpAvpq-aqgRPPYYT-PNQLAQMRPNP-RWQq-----GGRPQGFQGMPSa------i 453 human
Q9ZQA8       403 s------ssasVNPGTY---------------APLYYTnTHPGMVYQSYPlMWK-------SANMIGSSYPN-------- 446 thale cress
AAF70533     408 h-------qpmPFVGSQ-------G--------RPMRG-RGGRQQLGGRAqGHP--------MPMPSPQQPQ-------- 448 Leishmania major
AAC02537     389 p-------mgsLMGGMM-------G--------PQLGF-MGPQAMFNGVPfVNPr------MSMMPTPMGMG-------- 431 Trypanosoma cruzi
XP_001350640 567 qfsqntlsygrPVITAFnqnnlisWrhqqaaqQQAVHQ-QAVHQQAAQQQlNFNtnlrgqINQMRLYTQNNMmnnnlnqn 645 Plasmodium falc...
O64380       479 SGP----------GNfIVPYPLQRqp------------qTGPRmgfrrga----------tnvqqhiQ------------ 514 thale cress
Q13310       454 RQSgp-------rPT-LRHLAPTGs-------------eCPDRlamdfggagaa--qqgltdscqsgGvptavq-nlapr 509 human
Q9ZQA8       447 -SE----------AVtYPPMVAN----------------APsk------------------------------------- 462 thale cress
AAF70533     449 APAq---------PQgFATPSAVG-------------------------------------------------------- 463 Leishmania major
AAC02537     432 GQLr---------PMgPTPMNQVR-------------------------------------------------------- 446 Trypanosoma cruzi
XP_001350640 646 KPNaqlhhnqqyvPNaLAQNGQQQpnlnaagqhnaqqlqQQGNnqllnnnmrnmnnranrnmgnlgnMnnqkqlplninn 725 Plasmodium falc...
O64380       515 -QQQLMHRNPSPGMRYMNGa--SNGrn--gmDSSVPQgilp------piipLPIDASSISHqk------apLLPISKLTS 577 thale cress
Q13310       510 aAVAAAAPRAVAPYKYASS---VRSp-----HPAIQP--------------LQAPQPAVHV----------QGQEPLTAS 557 human
Q9ZQA8       463 nRQNRIGKLDRNAVSYVPNv--YQStq---mLPLSRDf------------sKQQHSRTYGR----------GKEMKKSIQ 515 thale cress
AAF70533     464 -FVQATPKHSPGDVPETP----------------------------------PLPPITP--------------------Q 488 Leishmania major
AAC02537     447 -ARPMPQRPPMQPIMAPP----------------------------------PQPQSLASQ-----------GQN--LST 478 Trypanosoma cruzi
XP_001350640 726 kQQNAASQANQMNHQAQPQgaqAQQknpqqmQQVPQGnnfkftaqarnrmeLPNKNANKVNtmnnnmnvnfNNNSTLTAA 805 Plasmodium falc...
O64380       578 SLASASPADRTRMLGEQLYPLVERHEPLHVAKVTGMLLEMDQAEILHLMESPEALKSKVSEALDVLR 644 thale cress
Q13310       558 MLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQ 624 human
Q9ZQA8       516 QRQSETVGMEMQLLGELLHPLVEKLEPQLANKITGMLLEMDKSELLLLLKSPEDLAVRVDEAFEVLK 582 thale cress
AAF70533     489 ELESMSPQEQRAALGDRLFLKVYEIAPELAPKITGMFLEMKPKEAYELLNDQKRLEERVTEALCVLK 555 Leishmania major
AAC02537     479 VLANLTPEQQKNVLGERLYNHIVAINPAAAAKVTGMLLEMDNGEILNLLDTPGLLDAKVQEALEVLN 545 Trypanosoma cruzi
XP_001350640 806 ALASAPPSMQKQVLGENLFPLVANYHPTLAGKITGMMLEMDNSELLILLENEEQLKKKIDEALVVLQ 872 Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap