Conserved Protein Domain Family
A_thal_3515

?
TIGR01627: A_thal_3515 
uncharacterized plant-specific domain TIGR01627
This model represents an uncharacterized domain found in both Arabidopsis thaliana (at least 10 copies) and Oryza sativa. Most member proteins have only a short stretch of sequence N-terminal to this domain, but one has a long N-terminal extension that includes a protein kinase domain (pfam00069).
Statistics
?
PSSM-Id: 130688
View PSSM: TIGR01627
Aligned: 3 rows
Threshold Bit Score: 388.108
Threshold Setting Gi: 9665091
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB62301  82 SNLPTSAINALLHYASrSNDSFHMSYGEMKSISDVLRRCAPpCNLLVFGLTHETLLWKSLNHNGRTVFIEEN--RYYAAY 159 thale cress
AAF97282  67 TKMPLSLSDALVHYVT-SNVTPQQTFDEVSVSKRVLDKKSP-CNFLVFGLGHDSLMWASLNHGGRTLFIEED--QAWIAI 142 thale cress
CAB36733  79 TTFRLSPADSSQQLRA-NEGPTALMEKELKLLSDTVTRRSP-CNILVFGFAPQYLMLSSINTRGITVILEDEpaKIMIPK 156 thale cress
CAB62301 160 FEEIHPEIDVFDVQYT-TKAHEAGELVTAAKEaAgnECRPVQ---NLlFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDA 235 thale cress
AAF97282 143 VTKKFPNLESYHVVYD-TKVKDSDKLMELGRS-E--ECRSVSd--PR-NSKCDLALKDFPADFYETKWDLIMVDAPTGYH 215 thale cress
CAB36733 157 AEVNPNNTRIYSLKYHqMEVRNAYNLLQHARAnP--ACAPNMnnqHQgSSDCKLELRDLPQQVHNTKWDVIVVDGPRGDD 234 thale cress
CAB62301 236 HEGPGRMSSIFTAAVLARSKKGGtPkTHVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDknSTK---FC 310 thale cress
AAF97282 216 EEAPGRMSAIYTAGLLARNREDG-E-TDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHR--ARAgrpFC 289 thale cress
CAB36733 235 LETPGRMGSIYTAAVLARKGSSNsT-TDVFVHDVHRTAEKWLSWEFLCQENLVSAKGTFWKFRIKRQSnaSR----FC 307 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap