Conserved Protein Domain Family
ytfJ_HI0045

?
TIGR01626: ytfJ_HI0045 
conserved hypothetical protein YtfJ-family, TIGR01626
This model represents sequences from gamma proteobacteria that are related to the E. coli protein, YtfJ.
Statistics
?
PSSM-Id: 130687
View PSSM: TIGR01626
Aligned: 3 rows
Threshold Bit Score: 318
Threshold Setting Gi: 1176921
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44478         1 MKKQILALVCGVIFSSSTWAHNLQLEQSLPSVKVSEYGEIVLSGKDTVFQPWGSAELAGKVRVVHHLAGRTAAKEXNQSM 80  Haemophilus inf...
WP_001527140  21 MTLRKILAMSCLLLPIMACAHNLEVNQRVPPVGIADRGELTLNKDEFSYKNWNSAQLAGKVRVLLHIAGRTSAKEKNATL 100 Salmonella ente...
WP_000792388   1 MKNKTLIALLLACSPTLAFAHNLTVGSPVPAVGVEKHGEIVLQDNNINYQKWRSADLLGKVRVIQAIAGRSSSKEMNAPL 80  Vibrio cholerae
P44478        81 IDVIKASHFNPVKYQTTTIINADDAIVGTGMFVKNGAKKGKQENPHSQVVLDDKSAVKNAWGLNSKDSAIIVLDKTGKVK 160 Haemophilus inf...
WP_001527140 101 IEAIKSAKLPHDRYQTTTIVNTDDAIPGSGMFVRSSIESNKKLYPWSQFIVDSNGVARNAWQLKEEGSAVIVLDKDGRVQ 180 Salmonella ente...
WP_000792388  81 MAAITAAKFPAESYQTTTIINQDDAIWGTSSFVKSSAQDSKKEFPWSSMVLDEFGLVAQAWQLQAESSAIIVQDKQGNVL 160 Vibrio cholerae
P44478       161 FVKEGKLSDSDIQTVISLVNGLTK 184 Haemophilus influenzae Rd KW20
WP_001527140 181 WVKDGALTQQEVQQVVDLLHKLLS 204 Salmonella enterica
WP_000792388 161 FVKEGALNEADIQTVLGLIQQNL- 183 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap