Conserved Protein Domain Family
RluA-like

?
TIGR01621: RluA-like 
pseudouridine synthase Rlu family protein, TIGR01621
This model represents a clade of sequences within the pseudouridine synthase superfamily (pfam00849). The superfamily includes E. coli proteins: RluA, RluB, RluC, RluD, and RsuA. The sequences modeled here are most closely related to RluA. Neisseria, among those species hitting this model, does not appear to have an RluA homolog. It is presumed that these sequences function as pseudouridine synthases, although perhaps with different specificity. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 130682
View PSSM: TIGR01621
Aligned: 3 rows
Threshold Bit Score: 402.356
Threshold Setting Gi: 1175071
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P43930         2 EIEVVYQHSDFIIINKSEGISVHKDQEEQGLTELVAKQLNVPKVWLVHRLDKVTSGLLILALNAESAAEFSRLFSEHKIH 81  Haemophilus inf...
WP_000459686   1 MFDILFTHPDFLLINKHPNVSVHKDDGDTMLLQEVATQTGDGQLYLVHRLDKMTSGILLLARNATAASELSQGFAKRKVE 80  Vibrio cholerae
WP_014581666 182 MLEILFRHQDFVAINKPGGISVHQDSGETGLARTLAIQLGVERVWLLHRLDKQTSGILLFALNKESASALSGQFAGKSIK 261 Neisseria menin...
P43930        82 KTYLALSNQKPKKKQGLIIGDMKKAREGAWKLCQTKDNPAITRFESVSCEPNLRLFILKPQTGKTHQLRVAMKSLGSPIL 161 Haemophilus inf...
WP_000459686  81 KFYLAIGSKKPKKKQGLICGDMERSRRSSWKLVNSQENPAITQFFSAAAATGERLFLCKPHTGKTHQIRVALKSIGSAIV 160 Vibrio cholerae
WP_014581666 262 KTYLALSDRKPSKKQGWIKGGMEKSRCGMWKLTRNTENIAVTRFHSISIAEKLRLFILEPHTGKTHQLRVAMKSLGSPIL 341 Neisseria menin...
P43930       162 GDGLYGKnTEKIDRTYLHATQLEFDYLNNFISVTCLPSQG----QFWIKPTVFEQIQVYLTK 219 Haemophilus influenzae Rd KW20
WP_000459686 161 GDPIYNT-ADESDRGYLHAFALRFTYQGEVYQWLCDPRQFshlgQKWHEEAVNQGIENWLSP 221 Vibrio cholerae
WP_014581666 342 GDSLYGG-T-ESETMFLYAWKIQFDYQNRQIEIVAPLKN------EWQTENIHRALEEFCME 395 Neisseria meningitidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap