Conserved Protein Domain Family
hyp_HI0043

?
TIGR01620: hyp_HI0043 
TIGR01620 family protein
This model includes putative membrane proteins from alpha and gamma proteobacteria, each making up their own clade. The two clades have less than 25% identity between them. We could not find support for the assignment to the sequence from Brucella (OMNI|NTL01BM0951) of being a GTP-binding protein.
Statistics
?
PSSM-Id: 130681
View PSSM: TIGR01620
Aligned: 3 rows
Threshold Bit Score: 441.629
Threshold Setting Gi: 499274167
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P43931        41 AQLEQALKPKSSFRKTLLKFTALLFGLATVAQSVQWIWDSYQKHQWIYLAFALVSLIIILLGIKEIICEWRRLVRLKKRE 120 Haemophilus inf...
P45525        54 AVMDAALRPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVVTEWRRLWRLRQRA 133 Escherichia coli
WP_010971560  63 LPVATPKKSRFSFGKLGLGALGVLFSLAFGLWADQLIRNLFSRSDWLGYTATIALIVALFAVLALVGREVFGIMRLNAVQ 142 Agrobacterium f...
P43931       121 QWQQQSQQIWLESAVKNGdvfsvhnaeksKILCLDIAKSLGLENDSPTVIQWQHQLNEAYSAQEIAHLFSRHVLSSFDAQ 200 Haemophilus inf...
P45525       134 HERDEARDLLHSHGTGKG-----------RAFCEKLAQQAGIDQSHPALQRWYASIHETQNDREVVSLYAHLVQPVLDAQ 202 Escherichia coli
WP_010971560 143 SLKADAETASLDKSPKPAr----------AIVTRLNAVLSHRAETAKGRAALKETENDVIDGPHLIELAERELLVPLDRQ 212 Agrobacterium f...
P43931       201 AKKLISKMAAESAVIVAISPLAVVDMFFIAWRNLRLMNKIAEIYGIELGYFPRIRLLRMVLVNIAFAGATEVAQDIGMDW 280 Haemophilus inf...
P45525       203 ARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLINRIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDW 282 Escherichia coli
WP_010971560 213 ARALILNSSKRVSVVTAVSPRAVVDLAYVLFEVTRLVRAMAELYGGRPGTLGMLKLLRDVVAHLAVTGSIAVGDGLAQQV 292 Agrobacterium f...
P43931       281 LSQDVTAKLSTRIAQGIGVGLLTARLGVKAMELCRPLAFQLNEKPKLSHIQQELLSSVK 339 Haemophilus influenzae Rd KW20
P45525       283 MSQDLAARLSTRAAQGIGAGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVK 341 Escherichia coli
WP_010971560 293 LGHGLASKLSARLGEGVINGLMTARIGIAAMDLCRPLPFRAVKRPGIGDFMSDLTPDLS 351 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap