Conserved Protein Domain Family
hyp_HI0040

?
TIGR01619: hyp_HI0040 
TIGR01619 family protein
This model represents a hypothetical equivalog of gamma proteobacteria, includes HI0040. These sequences do not have any similarity to known proteins by PSI-BLAST.
Statistics
?
PSSM-Id: 130680
View PSSM: TIGR01619
Aligned: 2 rows
Threshold Bit Score: 452.119
Threshold Setting Gi: 499209256
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P43929         2 DMANWQNYRSTVNGMPAVFTANIEDVEKYHGKGLDKIVQFTIDYQADDETGLPSEVEYDKLINRVFKILTQLTALPNVFF 81  Haemophilus inf...
WP_010906796   3 KGQSWQNYRSVLNDKLAIFSVNLEVLHQFPSSKSHHIIQFKFPYAMLDENALPDPSFYQTLMRQIVKLWTQLSALPDTLY 82  Pasteurella mul...
P43929        82 AGHFICNSQIKIHFYCKHENLIVETLQQIDFVKDINVQKDLIWDTYFDFLLASPLEIKLNATEELLDLLKSKGRNLSDTY 161 Haemophilus inf...
WP_010906796  83 AGHVLSAGHAQLYFYCDNTEPFLEVLKQFEEISAIEIQYDPHWDIYFDFLLPSPLEMKIHATEEVLELLTKNGRDLAALY 162 Pasteurella mul...
P43929       162 LVEHSFHFDEEQKMFPFMDELSLGDYSFTTLQYSAQAIQFNEDdEPYFLVKLEQEISLENSEIFEQVERFEKLAEQFSGE 241 Haemophilus inf...
WP_010906796 163 TIEHSFRFEEEANMFAFMDYLHSQSITLVSMQYSQLPVMLEED-EPVYLVRLEQELSLDNSQIFNYVEQFEDIANQFSGE 241 Pasteurella mul...
P43929       242 YIGWECDSL 250 Haemophilus influenzae Rd KW20
WP_010906796 242 YAGWECDAI 250 Pasteurella multocida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap