Conserved Protein Domain Family
235kDa-fam

?
TIGR01612: 235kDa-fam 
reticulocyte binding/rhoptry protein
This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.
Statistics
?
PSSM-Id: 130673
View PSSM: TIGR01612
Aligned: 2 rows
Threshold Bit Score: 3884.33
Threshold Setting Gi: 675229506
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_726044    1 MKKLIYITTTYIVLFTSLGVIYGKKIETGKKNHDGQLNNFYLYNNLKGINFNNSNSSNEEQYNNKNDVINd-KFIQPNSI 79   Plasmodium yoeli...
CDS44097     7 MKKFIYITTTYIVLFTSLEIIYGRKIETEKKNHDAQLNSFYLYHNLEGVNLNDSNSSNEKQYNNKNNAINdqTFIQPHSI 86   Plasmodium yoelii
XP_726044   80 TYLENQKDTANDKVILYNDYTNKNDLDTFKIFNNDNEKTNRKAXIVKSSFIQNSNPTRFDSSMYNTIDILYNVSGPNENL 159  Plasmodium yoeli...
CDS44097    87 TYFRNQKDTANDKITLYNDYTIKNNFNAFKSFNNDSEKTDRKATIVKNSFIQKSSAPSFDPDIYNEIDIIYGASYTNENL 166  Plasmodium yoelii
XP_726044  160 KYFYVKLYFYQELRTFLNNIYSNAKKPVNIPRSTPLQIDNDINLIIKECEPLKTNIINEMSKLHNPLYEFYKEPTKDDYN 239  Plasmodium yoeli...
CDS44097   167 EFFYAKLQICYDLRTIDSKGYYSSKRLLDSILNKLKQIQKDIIAIKKECEPRRTNVIGEMVKIQDPLYEFYKEPIHSYYN 246  Plasmodium yoelii
XP_726044  240 PYSNYRKIYVDCMIPRFKKLASKIDAAISSMQSEYDHLCYYEYWNVDALYKKYSANTKEYMDTELYNIKSHSVIYDMGLR 319  Plasmodium yoeli...
CDS44097   247 SYEISKKDYVNCILPRFKNLEPILDGILSSLKLEYDYVGYYSYWDIDAAYKEHATITHKHILAFLNDVKKHPMPNDKETV 326  Plasmodium yoelii
XP_726044  320 SHGNRLIKILESEGEQGNIISKLKFLSNEIEYTLNKSDNYKDECTSNYTFMVNYVQRDTYTQYYYYYLREIKKIAQQRAN 399  Plasmodium yoeli...
CDS44097   327 PHIKSLIQILESEGEQKHLKNKLIFLEKQFEDVIHKSSIYLEKCLSSHLLMEDYLKDSKISPYYYEFLEKIKRISKRREI 406  Plasmodium yoelii
XP_726044  400 FNYNFNKLKHLKLLYKQQEDIMRNFHKTIERLIFGKPDPNNTNVFKEYIYEFNLWIPKSKLTLLEKRFFEIFEEKWNSYE 479  Plasmodium yoeli...
CDS44097   407 FFYNAKKLKYLEIVYNHQKEVLNSFVKTLGRLLIEKPDPNNNQIFKDDFDEFYKPIPKSNLKALETRFFEIFKQEWGSYD 486  Plasmodium yoelii
XP_726044  480 IKKDIDENSKQYNVVKLILQYMKELTDVIDFMENYQPDeVPTRRIIGFEVEWRIKALLYSEVEAGVKKSYESVKNWRKSI 559  Plasmodium yoeli...
CDS44097   487 NKKTLGKNVNQDNTVRLILMRMKDFKDIIDSMELYKRR-VTSKNKILSDIDQNLNKKTYKEIENGLKESYTLATNWKRLK 565  Plasmodium yoelii
XP_726044  560 LEINKKLEEENEKVIKLETQIKDLFNQYLKIIDENIYINKLKLELKEKIKNISDKNEYIKKAVDLKKIIENNNAYIDELA 639  Plasmodium yoeli...
CDS44097   566 HKIKTELEEYNEDSIHLEKEINNLFDKYLEIDDEIVYINTLKLELKEKIKNISDKNEYVKKAIDLKKVVENNNAYIDELA 645  Plasmodium yoelii
XP_726044  640 KTSPYQVPEHLKSTDTIYSTIKSELSQIYEDDIDKLYNELSSIVQENDIDNVEDKTKLDDLQSKIDNVYSKIQNMETATV 719  Plasmodium yoeli...
CDS44097   646 KISPYQVTEYVKNKDKIYSTIKSELSKIYQGDLDALYNELSSIVKENAVDNTEDKAKLEDLKSKIDKEYDKIQNMETETV 725  Plasmodium yoelii
XP_726044  720 ESHLTNIETNKNKLSDTIVEIKKYIYGEISKDLNKTLEDFKNKEKELSNKINDYAKENDQLNVYKSKISEIRNHYNDQIS 799  Plasmodium yoeli...
CDS44097   726 KLNLSTIENKKNELLSIIVEMKKHIHSELNNELNKIVEDFKSKEKQLSSNINDYSNYKDELNKYKSKISEIKSQYNDQSN 805  Plasmodium yoelii
XP_726044  800 IDNTKEEEAKQNYDQSKEYTKTISIKEDETSKTINEVKNMKDEFLSKVDKYINFENNCKENVDSEHTQFTELTNKIKAEV 879  Plasmodium yoeli...
CDS44097   806 IDNIKDEDAKQNYEKSKEYIKTISVKEDEIFKIINEMKFMKDDILNKVNVFVNLENNHKEKINSGHESFAELVNKIKNEI 885  Plasmodium yoelii
XP_726044  880 SDEKLSIYENKFNDSKSLINETNNSIEKEYQNINTLKKVDEYIKVCESTKESIKNFHNKQTILKEKLNQNIKTIKETNSI 959  Plasmodium yoeli...
CDS44097   886 SDDQLNDYEKNVNDSKSLINEITKSIEEEYQNINTLKKVNGYLKICKNTTESIEKFRNKQNKLNEILNKNIDVIKNSNLI 965  Plasmodium yoelii
XP_726044  960 EKSYKDKFENTLINKINELDKAFKDASLNDYESNNNELMQYFNNLKANLGKNKENMLYHQFDEKEKAVNNIIQKIEDINK 1039 Plasmodium yoeli...
CDS44097   966 EKSYTNQFDNTLTDKKTELEKIFTELSLSSYEAKNNELIKYFNDLKENLGTPKGNTLYQQFDENEKATNDIEQKSVNANK 1045 Plasmodium yoelii
XP_726044 1040 NIPNIEIAIYTSIYNISEEIENEIGKNIESLNTNVLEKVNTNVTNFNKIKEKLKLYNFSDFGKEGNIKYTNEVNKIKDDI 1119 Plasmodium yoeli...
CDS44097  1046 NVSNIEMVIHTSIYNIIDEIEKLIGKNIELLNKEILKEAEISITNFNEIKEKLKHYNFDDFVKEENIKYADEINKIKNDI 1125 Plasmodium yoelii
XP_726044 1120 KNVNQQIDHHINELEEIKKKSENYVDEMKAQINKLEKVADTAISNDNVEGIEKKQQNIVTKIDKKKNIYEEINKLLSEIS 1199 Plasmodium yoeli...
CDS44097  1126 KTLDQKVDKNIKALTEIKNKSENYINEIKTQISDLEDVTDKTIYNEDPKEIEKKIENIVTKIDKKKYIYDNMKKLLNEIA 1205 Plasmodium yoelii
XP_726044 1200 KIEKDQTSLEKVKGINLSYGQNLGTLFLEQIDEEKKKSEHTIKAMEAYMEDLDNIKKKSQeienemgiemdiNKEMEVLN 1279 Plasmodium yoeli...
CDS44097  1206 EIEKDKTSLEEVKNINMSYGKSLNKLFLEKIDEEKKKSENMIKSMEKYIKDLDEIKEQSP------------KAEMNTFN 1273 Plasmodium yoelii
XP_726044 1280 ISHDDDKKYHTISKNHNENISDIRNKSLKIIQDFSRESDINDIKKELQKNVSESQKHNSEINQYLSKIANIYNILKLNKI 1359 Plasmodium yoeli...
CDS44097  1274 ISNSKYKDHYITSQKNDKSISDIREKSLKLTEGNYEKSNINDIKKTLQTYLLDAQKHNSDINLYLNEITNLYNILKLNNI 1353 Plasmodium yoelii
XP_726044 1360 KKIINKVKEYTNEIEKNNKNINDELSNSEKLIKKIKDDISLKECKSKIESTLDDKDIDGCIQNIKVLKTHILSEETNINT 1439 Plasmodium yoeli...
CDS44097  1354 KNIIDEVKEYTKKIEEYNKNVKSELDKSETLIKTIKENSNLETCKSKIESTVDGKDINECIKKVTESKNYILSEESNNDT 1433 Plasmodium yoelii
XP_726044 1440 YFKNADEYNKNVLLNFNNIEMADNKSQYILKIKKNNGTNDHDYNINELKEHKDKSNGYKTEADKNKKAIEKNKELFEQYK 1519 Plasmodium yoeli...
CDS44097  1434 YFKNAKENNENVSLLFKNIEMANNKTQHIMKNQKDNATSDMDFNLNELKENIDKSKKCKDEADKNAKQTEKNKILFKQYK 1513 Plasmodium yoelii
XP_726044 1520 QEVTVLLNKYYAVELKNKFDKTKNDSEQIIKEIKDAHNKFILEAGKSEQKMKEIKNEQIRIEDEVAKNDKSNKAIIDIQL 1599 Plasmodium yoeli...
CDS44097  1514 KDVTELLNKYSELAIKNNIAQTKKDSNIIINEIKELKKQITLQAETSEQKINKIKKEKFTIEDDAANNNKSNKAAIGIQT 1593 Plasmodium yoelii
XP_726044 1600 SVEPFETKFLKISDIRTKSNDCLKETESIEKKISTLSIDTQETKLKengdnlnTLQEFLESLKNQKKNIEDKKKELDEVN 1679 Plasmodium yoeli...
CDS44097  1594 SLENLENKLLKITNIKKKINDCLTETESIEKQISSFSINSQDTELS-------SLQTFLESLKDQKKNIEDQKTELDNLD 1666 Plasmodium yoelii
XP_726044 1680 SKIEKIKIDVNQHKKNYEIGIVEKINEIAKANKNKIESTKELIKPTIERLISSFNTNDLEGIDPNEKLGEYNTEMGIIYN 1759 Plasmodium yoeli...
CDS44097  1667 SEIKSIENDVDQHKKNYEIGIIEKIKETAITNKEELESIKTSIESTIKNVTSSFNTNDLEGINTNENLEKYNTEINDIYE 1746 Plasmodium yoelii
XP_726044 1760 EFMELYNLIAGYLKTVSKESITYNEIKNTRINAQNELLKNIESEKKSKSYLDDIEANEFDRIVTHLKKKLDNVNVKFTNE 1839 Plasmodium yoeli...
CDS44097  1747 EFIKSYNIMTNCLETVSKEPITYDQIKNTRITAQNEFLKIIEIKKKYNSYLDNVKIKEVDRIINHFKSKLDHVNDTFTKE 1826 Plasmodium yoelii
XP_726044 1840 YSKVNEGFDNISKSINNVKNSTDENSLLNILNQTKEMYANIVSKKYYSYKYEAEKIFINISKLANSLNIQIQNSSGVDLL 1919 Plasmodium yoeli...
CDS44097  1827 YSNINKGFDDISKSIENVKTSTDENLLFDILNKTKDAYMGMIGKSYYSYKDEAESIFKNMVKLAYSINIQIQNNSGINLF 1906 Plasmodium yoelii
XP_726044 1920 KNINIAILSYLDSPKEDTLTFIPSPQKKSETYTKIRDSYNTLLDIFKKSQYLHKKEQQTLNLIFENRRLYEKVQATNELK 1999 Plasmodium yoeli...
CDS44097  1907 DNVNIDVLSSLNSETKDTLKFIPSPENEPEIYTKIRNSYDTLLNIFKKSQDTHKKEQDTLNIMNKNQQLYEKIRQSNELK 1986 Plasmodium yoelii
XP_726044 2000 DTLSDLKYKKEKILNEVKLLLHKSNELNKLSCNSQNYDTILESSKYDKIKEKSNNYEKEKENLGINFDVKAMEEQFNNDI 2079 Plasmodium yoeli...
CDS44097  1987 GVLSDTKYKKEKILNDVKLVLHKFDELNQLTCDSQNYDTILELSNQNQIKTKIDNYEQEKRKFVMDFNVTIMEQKLDNII 2066 Plasmodium yoelii
XP_726044 2080 KDIEKLENnykhsekdNYNFSEENNNILQSKKKLKELTNAFNTEIKKIEDQIIEKNDLINKLIETRKQCLLFTYTTLVET 2159 Plasmodium yoeli...
CDS44097  2067 KSIEKFEN--------THDSSEKKDSNIQSNNQLNEMTELFNTEIKIIENKIIEKNGLIDQLTKMRKECLLFSYATLVET 2138 Plasmodium yoelii
XP_726044 2160 LKSKVTNHSEFITSAAKFSKDFFKYIEDISNSLNDDIDTLQINYNLNQTNKHVPSilaDATKDHNNLIEKEKEATKIINN 2239 Plasmodium yoeli...
CDS44097  2139 LKSKVINYSEFITSATKFSKEYFEFINNSTDSLNDNIDALQTKYNLNQTKKHMIS---DITNDKNNLIEKEKEATQTINN 2215 Plasmodium yoelii
XP_726044 2240 LTELFTIDSNNIDADTLHNNKIQIIYFNSELHKSIESIKQLYKKMNIFKLLNISHINGKYFDISKEFDNILQMQKHKLTE 2319 Plasmodium yoeli...
CDS44097  2216 LTKLFTIDFQNADAKILYYNNLQMTYFYSQLQKSIESIKKLYRKIRAFKLSNIYLINEKYSDISKQFDNIIQLQKNKLTE 2295 Plasmodium yoelii
XP_726044 2320 NLNDLKQIDQYISDKKNKFLHALNETTNPNLNTLKEIYHDIVNYERQLDEIKNISNKENENITSYIDTITKLTGKVQNIL 2399 Plasmodium yoeli...
CDS44097  2296 NLNNLKEIEQYVSDKKRIFLHTVNGNTNFNFNALKEIYDNIISRENKAHGIENVNNKESENIMQYTDTITKLTEKIQDIL 2375 Plasmodium yoelii
XP_726044 2400 NFVTTYENNNNIIKQHIQDNDENHVSQIKDNLKKTIQSFQEILNKIDEIKAQFYGNNNISNVITTISQNVNDVKNHFSKD 2479 Plasmodium yoeli...
CDS44097  2376 IFVTTYENDNNIIKQHIQDNDENDVSKIKENLKSTIQSFQHIQNKINEIKAQFYGGNNINSIIITISQNANDVKTLFSKD 2455 Plasmodium yoelii
XP_726044 2480 LTIENELIQIQKSLEDIQNSTHEIRSEQITKYVNAIYNHIEEQTKQIQNNSYKDEvykineIDNIIQKIINYNKEPEVKL 2559 Plasmodium yoeli...
CDS44097  2456 LTIENELTRIQSRLENIKNAAHENRSEQIVQYTNAIHNYIEQQFNKIENNSNQDE------IDSTMENIRNYNKESEVKL 2529 Plasmodium yoelii
XP_726044 2560 HAIIDNQNKVTSIISRIKNLINLIESEYSnNNNVSYNVAIKHTENANNIILDLNMSQNMLNHLIHRNLNIINNLKNIKQH 2639 Plasmodium yoeli...
CDS44097  2530 QQISNYKNEFASIIPDITNLIALIKSKYG-NNNISYKVAIKHEEDAQNILNDLNKSQNILSQSINKNKKSIEDLGYKKHG 2608 Plasmodium yoelii
XP_726044 2640 MISRNNLHTINSQEETSKIKYPSNTYYNNVNDtkYKNHQHSNSGKKGSSKTKNAGDSVKYAGAIVFGLVVCYAISIFKKQ 2719 Plasmodium yoeli...
CDS44097  2609 IHNNNNLHTINKHQEISQIKHPNNTSHNNNDDakYKNYHHSNSDEKGSSKTKISGNSIKFAGAIGVGLVAFYVIANFNKK 2688 Plasmodium yoelii
XP_726044 2720 DEKNEINLGNDEKNYGESENIYFEREDEIIEIDINED 2756 Plasmodium yoelii yoelii 17XNL
CDS44097  2689 NDTNEMDLDNDQSFCNEGEIKYFERDDEIIKINMNED 2725 Plasmodium yoelii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap