Conserved Protein Domain Family
tail_tube

?
TIGR01611: tail_tube 
phage contractile tail tube protein, P2 family
The tails of some phage are contractile. This model represents the tail tube, or tail core, protein of the contractile tail of phage P2, and homologous proteins from additional phage. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130672
View PSSM: TIGR01611
Aligned: 4 rows
Threshold Bit Score: 274.002
Threshold Setting Gi: 16502715
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD01872       4 IEINRITNANIYLDGTNLLGRAEEVKLPDVSMIMQEHKALGMVGKVELPAGFDKLEGEIKWNSfYRDAMLSAANPYKSLA 83  Salmonella ente...
CAD15619       2 ALPRILKHFNVFADGVVHTGECEEINLPKLARKLEEYRAGGMNGAIQIDMGNEKLELETTYGG-PMREILKQYGTTAVDG 80  Ralstonia solan...
WP_010893252   3 APRHLLKHLNLFIDGKGYAGQVEDINLPKLTLKTEEFRGGGMLAPVELTMGMEKLETDVSLIC-YSSDALLLFGVTEGKQ 81  Xylella fastidiosa
WP_003085175   1 MIPQTLTNTNLFIDGVSFAGDVPSLTLPKLAVKTEQYRAGGMDAPVSIDMGLEAMEAKFSTNG-ARREALNFFGLADQSA 79  Pseudomonas
CAD01872      84 LQCRsSVQRYSSQGLIDEIPLVTFLTIMFKKNPLGTFKQHENAEFSSSFTCTYIRQVLDGEELLQLDYLANIFRVGGVDQ 163 Salmonella ente...
CAD15619      81 AMIR-FAGAYQHEDTKEVDAVEIVVRGRHTEIDFGTAKAGAKAPFKVKSSLTYYKMTVNGEVWCELDFVNFVEVVFGEDR 159 Ralstonia solan...
WP_010893252  82 VNCT-VRGFLESFD-GTTTTLAIHLRGKVKEIDRGTWKPADKSTLKLALALSYYKEVHNATVIHEIDVENMIFQQNGIDL 159 Xylella fastidiosa
WP_003085175  80 FNGV-FRGSFKGQK-GASVPVVATLRGLLKEVDPGDWKAGEKAEFKYAVAVSYYKLEVDGREVYEIDPVNGVRAINGVDQ 157 Pseudomonas
CAD01872     164 LTDYRINIGG 173 Salmonella enterica subsp. enterica serovar Typhi str. CT18
CAD15619     160 LAAQRRAIGL 169 Ralstonia solanacearum GMI1000
WP_010893252 160 LAPARNALGL 169 Xylella fastidiosa
WP_003085175 158 LAGMRNDLGL 167 Pseudomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap