Conserved Protein Domain Family
citD

?
TIGR01608: citD 
citrate lyase acyl carrier protein
This is a model of the acyl carrier protein (aka gamma subunit) of the holoenzyme citrate lyase (EC 4.1.3.6) composed of alpha (EC 2.8.3.10), beta (EC 4.1.3.34), and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The acyl carrier protein covalently binds the coenzyme of citrate lyase. The seed contains an experimentally characterized member from Leuconostoc mesenteroides. The model covers a wide range of Gram positive bacteria. For Gram negative bacteria, it appears that only gamma proteobacteria hit this model. The model is quite robust with queries scoring either quite well or quite poorly against the model. There are currently no hits in-between the noise cutoff and trusted cutoff. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 130669
View PSSM: TIGR01608
Aligned: 4 rows
Threshold Bit Score: 119.179
Threshold Setting Gi: 1168955
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL95574   1 MVLKTVGVAGTLESSDAMITVEPANQGGIVIDISSSVKRQFGRQIEETVLNTIKELGVENANVKVVDKGALNYALIARTK 80  Fusobacterium nucle...
P02903     1 MEMKIDALAGTLESSDVMVRIGPAAQPGIQLEIDSIVKQQFGAAIEQVVRETLAQLGVKQANVVVDDKGALECVLRARVQ 80  Klebsiella pneumoniae
BAB80853   1 MEIKKPALAGTLESSDCIVSVEPSMDNTIEINLTSTVKKQFGNEIIKVAKETLKNLGVNSVVMEINDKGALNCVIEARIE 80  Clostridium perfrin...
O53077     1 MEIKKTAIAGTLESSDVQIMLSKG-TVGVEFDLVSDVAKQFADDIKSTIKETLGLYGIENAVVKVVDKGALDMVIKARTL 79  Leuconostoc mesente...
AAL95574  81 AAVYRAAESND-Y 92  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
P02903    81 AAALRAAQQTQ-L 92  Klebsiella pneumoniae
BAB80853  81 AAVCRASEINE-F 92  Clostridium perfringens str. 13
O53077    80 TAIQRALDAVDqP 92  Leuconostoc mesenteroides subsp. cremoris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap