Conserved Protein Domain Family
PST-A

?
TIGR01607: PST-A 
Plasmodium subtelomeric family (PST-A)
This model represents a paralogous family of genes in Plasmodium falciparum and Plasmodium yoelii, which are closely related to various phospholipases and lysophospholipases of plants as well as generally being related to the alpha/beta-fold superfamily of hydrolases. These genes are preferentially located in the subtelomeric regions of the chromosomes of both P. falciparum and P. yoelii.
Statistics
?
PSSM-Id: 162444
View PSSM: TIGR01607
Aligned: 4 rows
Threshold Bit Score: 481.974
Threshold Setting Gi: 82704884
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001350908  25 SFFNKDGLLIRTYSWTVKKAIGIIVLIHGLNSHFRLQYLKHNADIISNDKAVLINSDEYYIYKDSWIERLNNEGYSVYGL 104 Plasmodium falc...
XP_001347663  23 SYYNRKGILLKSYSWLVKNAIGIIVLVHGLSAHLRLQYLKLNVNVVNNDYATLIDADNYYIYEDSWIEEFNKNGYSVYGI 102 Plasmodium falc...
EUR62139      20 TFCNKDGLRIKSYSWIVKKALGIIILIHGLASHLRFGFLNKNAKIVSNEHAVLIDGDNYFLYEGSWIEKLNKSGYSVYGL 99  Plasmodium falc...
XP_726737     26 WFRNKNGLLLKTYGWIVKNAIGIILLIHGFKSHARLTFMKINLKMPNKNRGLVVDTNNYYIYKDSWIENFNQNGYSVYAL 105 Plasmodium yoel...
XP_001350908 105 DLQSHGKSDGWQNLRGNVNYFDDLVYDVIQYINKINSSVIKERedpkeySYSDYNYNFKNKMPnivRSPLYIMGLSMGGN 184 Plasmodium falc...
XP_001347663 103 DLQGHGESDGLDKLPLHINNFDDYVYDIIDYMRRINNSIVLEKsm---qKSTSNKYTIENREE---LLPMYLVGLSMGGN 176 Plasmodium falc...
EUR62139     100 DLQGHGESDGYQNLKLHIKDYDDYIYDLIDFIKRVKKSSILESe----tRSDTLDKEQIETFEn---LPIYLAGFSMGAN 172 Plasmodium falc...
XP_726737    106 DLQGHGESQSLENIRGHINCFDDLVDDVIQYMNHIQDEISNEN------KMDDESHDIVTTKKk--RLPMYIIGHSMGGN 177 Plasmodium yoel...
XP_001350908 185 IALRVLELIGKSK-EV---------------------------------------------------------------- 199 Plasmodium falc...
XP_001347663 177 IVLRTLEILGKSN-EI---------------------------------------------------------------- 191 Plasmodium falc...
EUR62139     173 IMLRAMELLNNTNdDL---------------------------------------------------------------- 188 Plasmodium falc...
XP_726737    178 IALRLLQLLKKEQ-Enkinsgdandnnmiediindmdnsndhaiedmnnthlitnsndcdsdnpcastssttnsidsasd 256 Plasmodium yoel...
XP_001350908 200 --------NDNLNVKGCISLAGMISIDENASKIPFKFKYFFIPLSRYVAYFFPTFRPS-P-NLNFEKFPYINDIINFDKN 269 Plasmodium falc...
XP_001347663 192 --------NSNLNIKGCISLAGMISVRMVGSIDSIKYKYFYLPVMKIFSRYFPTFRPGkK-KFKFEKYPFVNDLLFYDKY 262 Plasmodium falc...
EUR62139     189 --------ITKGSIKGLVSLSGMFSIKAVGSPDSFKYKYFFSPVMNLMSSIGPTDRIS-KsKKSYERCPYVNDLISFDKV 259 Plasmodium falc...
XP_726737    257 knegyynyFDKLNIKGCISLSGMMRIKSIFNDGNNSFKNVYLPIVNFMSRVAPNVLIP-S-GIRYSISKYVGSIYKHDKF 334 Plasmodium yoel...
XP_001350908 270 RYDKWITMRFAHQLIEATRNLRDDMKYIPKDIPVLFIHSKDDCACYYEGVEIFFNKLGINNKELHTIYDMDHLLTMEPGN 349 Plasmodium falc...
XP_001347663 263 RFKGRITNNLAREILVALDNLHNNIDDIPKNIPILFIHSINDCLCWYEGTVSFYNKLQIDNKELYTLEDMDHVISMEPGN 342 Plasmodium falc...
EUR62139     260 RYDGTITKNLAYGLMKSVDTLNKNMDRIPKNIPILFIHSKTDNICTYEDALLFFNKLNNSNKEIYTLENMSHVITIEKGN 339 Plasmodium falc...
XP_726737    335 RNNNGIKFKCMSELIKATITLDCDINYMPNDIPLLFVHSTGDSVCSYDGTVSFYNKASVSKKNLHHVDDMDHDITIEPGN 414 Plasmodium yoel...
XP_001350908 350 ERVLDKVITWIKG 362 Plasmodium falciparum 3D7
XP_001347663 343 ENVLKKILEWISN 355 Plasmodium falciparum 3D7
EUR62139     340 EKPLNKMIEWIQY 352 Plasmodium falciparum 7G8
XP_726737    415 EEILKKIIEWISN 427 Plasmodium yoelii yoelii 17XNL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap