Conserved Protein Domain Family
PYST-D

?
TIGR01605: PYST-D 
Plasmodium yoelii subtelomeric family PYST-D
This model represents a paralogous family of Plasmodium yoelii genes preferentially located in the subtelomeric regions of the chromosomes. These genes are generally very short (ca. 50 residues). There are no obvious homologs to these genes in any other organism.
Statistics
?
PSSM-Id: 130666
View PSSM: TIGR01605
Aligned: 3 rows
Threshold Bit Score: 72.9869
Threshold Setting Gi: 82705086
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_730645  4 VKIEDVSVEPIFGLGISITLYLIFYNVNTNXIYVPSRMFNQKMKLKSQNMQPKGE 58  Plasmodium yoelii yoelii 17XNL
XP_725408  2 LWVSIMFLDPIFGLGLSVILHLIFYNSITFIISVFNIYIMSKYVRKNENEDDYEK 56  Plasmodium yoelii yoelii 17XNL
XP_726821 21 LRVRVVFMEPIFGLGLSITLHLIFYNLNNNLIYVSSRMFNQEMMPKYS--TPNGD 73  Plasmodium yoelii yoelii 17XNL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap