Conserved Protein Domain Family
PYST-C2

?
TIGR01604: PYST-C2 
Plasmodium yoelii subtelomeric domain PYST-C2
This model represents a domain of a paralogous family of Plasmodium yoelii genes preferentially located in the subtelomeric regions of the chromosomes. There are no obvious homologs to these genes in any other organism. The genes found by this model often are associated with an N-terminal domain yoelii-specific domain such as PYST-C1 (TIGR01601).
Statistics
?
PSSM-Id: 130665
View PSSM: TIGR01604
Aligned: 3 rows
Threshold Bit Score: 141.65
Threshold Setting Gi: 83286716
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_728486  90 VPLTHSCNQTAGTSSNNNALPMVTVCLGKFQHAIPATDPNLLEVLLQLKGKLEKRLSNKNKSIPKKELKMQKKLSIILAK 169 Plasmodium yoelii ...
XP_728348  85 VPLTFPHNQIVVIYSSNESLPTVKIRIGTVESEFIPKDQKHLEDILKLQKTFEELYSNNNGYFPMGSLWREGIKPEFIPK 164 Plasmodium yoelii ...
XP_730282  11 VVSFILLIVTIQSFTNNEDLNKYVKKNKNVHDEYEL-----XXIYINNNEKFRHRSLSEYSLEDDYTFGSDTIKELSNNK 85  Plasmodium yoelii ...
XP_728486 170 KPELLWPL-LRVKEELEKESSNNNSSIPKVTLVVKNMLHEIPVKDPEHLEFFLRLKEELENYHqIENQENY 239 Plasmodium yoelii yoelii 17XNL
XP_728348 165 KQENLKEV-PQLKETSEKLYSNNDKSTSKEIFQMQQNMQNICENNPNLFKILLESKEPIEKYL-LKKKTSK 233 Plasmodium yoelii yoelii 17XNL
XP_730282  86 KSNCFNCFnIFKRNKKNKKSSNTNGFPSKVTLLVGNVPHSFPVQSPEHYQFLLNLKNRLDN-HpSNLKLNE 155 Plasmodium yoelii yoelii 17XNL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap