Conserved Protein Domain Family
phage_tail_L

?
TIGR01600: phage_tail_L 
lambda-like phage minor tail protein L
This model detects members of the family of phage lambda minor tail protein L. This model was built as a fragment model to allow detection of fragmentary sequences, as might be found in cryptic prophage regions. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130661
View PSSM: TIGR01600
Aligned: 3 rows
Threshold Bit Score: 392.382
Threshold Setting Gi: 447073849
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD15396       6 DIQRLEPGALVELFELDATGVGG-DVLRFHG--YAQVGSIWWKGSEYSPWPIEATGFARTGQGQQPAPRLAVGNVDGAIS 82  Ralstonia solan...
AAC82706      17 DIQSLSPSALIELFELDMSNTTSgGKLFFHAgtNELMEPVVWQGVSYEPWPIKASGFDKTGQGTLPRPKIQVSNFAGTVS 96  Yersinia pestis...
WP_001151105  11 ESVKSEQSPRVVLWEIDLTAQGG-ERYFFCNelNEKGEAVTWQGRQYQAYPIDGSGFEMNGKGSSARPSLTVSNLFGLVT 89  Escherichia coli
CAD15396      83 ALCLYTDDLVGAKVRRRRTLGRFLDARNFPEGNPEADPTEELPMEEWFIEQKTAETNETVEFELSSALDFNGVQLPRRQI 162 Ralstonia solan...
AAC82706      97 AEVQANDYLVGCRIIRKMTLARFLDAANFKDGNPTADPNQHFPDEMWFVEQKTLETHEVVEFELSSVFDLMGVQLPYRQI 176 Yersinia pestis...
WP_001151105  90 GMAEDLQSLVGATVVRRRVYARFLDAVNFVAGNPEADPEQEL-TDRWVVEQMSSLTAMTASFVLATPTETDGALFPGRIM 168 Escherichia coli
CAD15396     163 VANVCGWltVggYRGPECGYTGaAMFDRDDNAVSDPSLDKCGGRLSSCKCR--FGANELLPFGGFPAADLI 231 Ralstonia solanacearum G...
AAC82706     177 IKNTCPW--K--YRGPECGYTG-PYFDKNNQQTTMSGADYCTKRYDSCNARrnYFANGVIHFGGFIGATRY 242 Yersinia pestis KIM10+
WP_001151105 169 LANTCMWd----YRGDECGYNGpAVADEFDNPTTDIRKDRCSKCMRGCEMR-----GMVANFGGFLSINKL 230 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap