Conserved Protein Domain Family
PYST-B

?
TIGR01597: PYST-B 
Plasmodium yoelii subtelomeric family PYST-B
This model represents a paralogous family of Plasmodium yoelii genes preferentially located in the subtelomeric regions of the chromosomes. There are no obvious homologs to these genes in any other organism.
Statistics
?
PSSM-Id: 130658
View PSSM: TIGR01597
Aligned: 3 rows
Threshold Bit Score: 301.429
Threshold Setting Gi: 83317865
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_725964   1 MRVSILRFVFFSIIICFFEYAQNELYLVNERSIFLERNIIKFRSNRILADVDNQFDLNDFYESTLSLANQFNEYNADDKE 80  Plasmodium yoelii ...
XP_729255   1 MRFNILKYVFFSIIICSFEYAKNELYLVNERTICFERNIKIFRNNRTLADADNQFDLNEFYQSTLSLASQFNDCNDGNKE 80  Plasmodium yoelii ...
XP_731347   1 MRVSILKFVLFSIFICYFEYVKNELYLVNERNIYHERNITNFRNNRILADADNQFDLNEFYQSTLSLANQFNDDNDDDEE 80  Plasmodium yoelii ...
XP_725964  81 MTFLRNAIDSHIKKHKESNTLPDLNNVDKKTKKTILKLQRELEEIKKELANKSNSELEIQSIHDKRIIKKDENNSVS--- 157 Plasmodium yoelii ...
XP_729255  81 IAHLRNIIDSYIKKHKERSTILNLKNVDSKAKKLINKFRKELEELTKELDNEMNDELTIQPTHDKIIIKKDENSSVS--- 157 Plasmodium yoelii ...
XP_731347  81 IKYLQNIIDSHVKKHKENNTLPDLNSLDKKTKKLIDELQKEIEETKKELDNIRNNKLAIEPIQ---------NNPVSeee 151 Plasmodium yoelii ...
XP_725964 158 -GNEDFNQLENEVNSLEEEFKQF---------DLSGVDN--YKYKRKEDKLYKGLKLRLILMFFFSFATMVsGCVNLPLA 225 Plasmodium yoelii ...
XP_729255 158 -EHEELKQLENYKNSSVSEHEEFkqlendennEIASSSNnkLKIRRKLKKEVIKCIVTCLTFIVIVCSILI-GPVYLLAL 235 Plasmodium yoelii ...
XP_731347 152 eEEEDFKQLKNERNIVGNEHYEV---------DPKIEDE--SKTKRELTKLTKKLMVRGVVLTLLVLSLLVpGLIYFVFV 220 Plasmodium yoelii ...
XP_725964 226 IISLAISFESFIKSfqyIKLLYlhfFMFYRIMK 258 Plasmodium yoelii yoelii 17XNL
XP_729255 236 FIPSLISIYWSFWR---VDKYR---TKLKNISK 262 Plasmodium yoelii yoelii 17XNL
XP_731347 221 IMNVILSIGILIECckyVKLCFkeyksykkkkk 253 Plasmodium yoelii yoelii 17XNL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap