2IV2


Conserved Protein Domain Family
Fdh-alpha

?
TIGR01591: Fdh-alpha 
Click on image for an interactive view with Cn3D
formate dehydrogenase, alpha subunit, archaeal-type
This model describes a subset of formate dehydrogenase alpha chains found mainly archaea but also in alpha and gamma proteobacteria and a small number of gram positive bacteria. The alpha chain contains domains for molybdopterin dinucleotide binding and molybdopterin oxidoreductase (pfam01568 and pfam00384, respectively). The holo-enzyme also contains beta and gamma subunits. The enzyme catalyzes the oxidation of formate (produced from pyruvate during anaerobic growth) to carbon dioxide with the concomitant release of two electrons and two protons. The enzyme's purpose is to allow growth on formate in some circumstances and, in the case of FdhH in gamma proteobacteria, to pass electrons to hydrogenase (by which process acid is neutralized). This model is well-defined, with only a single fragmentary sequence falling between trusted and noise. The alpha subunit of a version of nitrate reductase is closely related.
Statistics
?
PSSM-Id: 130652
View PSSM: TIGR01591
Aligned: 7 rows
Threshold Bit Score: 1056.68
Threshold Setting Gi: 497675026
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IV2_X         6 TVCPYCASGCKINLVVDNGKIVRAEAAQG-KTNQGTLCLKGYYGWDFIND----TqiltPRLKTPMIRRqrG--GKLEPV 78   Escherichia coli
P06131         8 TICPYCGVGCGMNLVVKDEKVVGVEPWKRhPVNEGKLCPKGNFCYEIIHR----E----DRLTTPLIKE--N--GEFREA 75   Methanobacteri...
AAL81645      11 VVCPYCGFGCNL---LVDTITKKVRPYRg-EPNRGKLCPKGLFALEHVYS----K----DRLRYPLKRE--G--SDFKRI 74   Pyrococcus fur...
P07658         6 TVCPYCASGCKINLVVDNGKIVRAEAAQG-KTNQGTLCLKGYYGWDFINDtqilT----PRLKTPMIRRqrG--GKLEPV 78   Escherichia co...
WP_009989018 262 TVCIYCGVGCSFEIWTKGRKILKIEPKPEsPANGILTCVKGKFGWDFVNS----S----ERITKPLIRE--G--DKFREA 329  Sulfolobus sol...
WP_010913191 265 TTCAYCGVGCSFKAEVKDDEVIRMMPYKDgKANHGHSCVKGRFAYGYATH----K----DRILSPMIRE--KisDPWREV 334  Mesorhizobium ...
WP_009989210   6 TICPFCGVGCGLDFYVENNFIFRVSPSQEhIVSRGHVCGKGAVASEVIYA----W----DRLTYPLKRV--K--DTFVRT 73   Sulfolobus sol...
2IV2_X        79 SWDEALNYVAERLSaikeKYGPDAIQTTGSSRGTgNETNYVMQKFARAVIGTNNVDCCARVXHGPSVAGLHQSVGNGAMS 158  Escherichia coli
P06131        76 TWDEAYDLIASKLG----AYDPNEIGFFCCARSP-NENIYVNQKFARIVVGTHNIDHCARLCHGPTVAGLAASFGSGAMT 150  Methanobacteri...
AAL81645      75 SWERAISEIAEKIReiieNYGPSSIAFIASSKIT-NEENYLLQKIAR-LLGTNNIDNCARLCHESSVHALKLTLGAGIQT 152  Pyrococcus fur...
P07658        79 SWDEALNYVAERLSaikeKYGPDAIQTTGSSRGTgNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMS 158  Escherichia co...
WP_009989018 330 SWDEAISYIAKRLKeikeRYGPDSIGFIASDKMS-NEEAYLLQKLARAIIGTNNVDNSARYCQSPATVGLWRTVGIGADS 408  Sulfolobus sol...
WP_010913191 335 SWEEAIAHTAKEFRriqyQYGRTSIGGITSSRCT-NEETYLVQKLVRQGFRNNNVDTCARVCHSPTGYGLGQTYGTSAGT 413  Mesorhizobium ...
WP_009989210  74 TWDEAISDIASKLKeirsKYGSEAIAFYGGCQNT-LEEGYSFMKLARA-LGTNNVDSCARVCHEPSAMALKELVGIGASS 151  Sulfolobus sol...
2IV2_X       159 NAINEIDNTDLVFVFGYNPADSHPIVANHVINAKR-NGAKIIVCDPRKIETAR----IADMHIALKNGSNIALLNAMGHV 233  Escherichia coli
P06131       151 NSYASFEDADLIFSIGANSLEAHPLVGRKLMRAKM-NGAYFIVADPRYTPTAK----QADQYIPFKTGTDVALMNAMMNV 225  Methanobacteri...
AAL81645     153 NPYSDLEKFKALMIWGYNPAETHPVVMQYIMNAKK-NGAKIIVVDVRETTTMK----FGDYKVIIRPGTDITLANAIMNV 227  Pyrococcus fur...
P07658       159 NAINEIDNTDLVFVFGYNPADSHPIVANHVINAKR-NGAKIIVCDPRKIETAR----IADMHIALKNGSNIALLNAMGHV 233  Escherichia co...
WP_009989018 409 GTIRDIENANLIVIVGHNTTESHPVIGSKVKRAKKiNGSKIVVIDVRKHEIAE----KADLFIKPKPGTDAAVLAGVAKY 484  Sulfolobus sol...
WP_010913191 414 QDFDSVEFTDVAVVIGANPVSAHPVFASRLKKRLR-QGAKLIVLDPRRTEMVKsahiEADYHLPLKPGTNVAVLTSLAHV 492  Mesorhizobium ...
WP_009989210 152 VTVSEILNARNIVISGESVTDSHPVLSQYLVEAKR-KGVKIVVIDPRMTGTAR----IADLFLQISSGTDIYLYNAVANY 226  Sulfolobus sol...
2IV2_X       234 IIEENLYDKAFVASRT--EGFEEYRKIVEg--YTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETV 309  Escherichia coli
P06131       226 IISEGLEDKEFIEKRT--KNYEELKEVVSk--YTPEMAEEITQVPADVIRDIAIKYAKADKAAIVYSLGITEHSHGVDNV 301  Methanobacteri...
AAL81645     228 IIENRWYNKDFIEKRT--VGFSEIRMGVKk--YTPEYAEKITGVPARLIKEIAEAFAKAGSGAILWGMGVTQQIAGVENV 303  Pyrococcus fur...
P07658       234 IIEENLYDKAFVASRT--EGFEEYRKIVEg--YTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETV 309  Escherichia co...
WP_009989018 485 LIDQGWIDKEFIDKRV--NGFEEFKESIKg--FTLDYVEDITGVPRDQIIKLAEMIHNANSVAVLWGMGVTQHLGGADTS 560  Sulfolobus sol...
WP_010913191 493 IVTEGLFDEAFIRERCdwTEFQDWASFVAlpeNSPETVGKLSGVDPDLIRGAARLYAKGGNGAIYYGLGVTEHSQGSTTV 572  Mesorhizobium ...
WP_009989210 227 LISNGLYDSKFVKERV--ENFDEFREIVKs--YTIEEAERITSVSKDKIIEFARIIANKPT-ILSWGLGLTQ-SSGVNAV 300  Sulfolobus sol...
2IV2_X       310 RSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHR 389  Escherichia coli
P06131       302 MQTANLAMLTGNIGRLGTGVNPLRGQNNVQGACDMGALPTDYPGYRKVADQEVMEDVTCTWGCSDLGCEPGLKIPEMIDA 381  Methanobacteri...
AAL81645     304 LALINIALLLGYFGEKGG-LYPMRGQNNVQGAAYMGTLSEFLPGYVPLSDSEFRKKVAKLWGVEDLPTERGLYLTEYWDA 382  Pyrococcus fur...
P07658       310 RSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHR 389  Escherichia co...
WP_009989018 561 TIISDLLLITGNYGKPGSGAFPMRGHNNVQGVSDFGCLPNYLPGYQKLEDENVIAKFEEAWG-VKLNRNPGLQIPQMIEG 639  Sulfolobus sol...
WP_010913191 573 MAIANLAMATGNIGRPGVGVNPLRGQNNVQGSCDMGSFPHELPGYRHISGEAVRDIYESLWG-VKLDDEPGLRIPNMLDA 651  Mesorhizobium ...
WP_009989210 301 KAYINLALLTGNVGINGGGLLVYRGQTNVQGSGDLIKPDVFPNG--PMN-EENAKELSKIWGFVP-PIKKGLSITEAF-- 374  Sulfolobus sol...
2IV2_X       390 AAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAV 469  Escherichia coli
P06131       382 AAKGDLKVLYITGEDPVISDPDTHHVEEALNNLDFFVVQDIFMTDTAEFADVVLPAACWAEQEGTFTNGERRVQLIRKAV 461  Methanobacteri...
AAL81645     383 ILNGDLKVLYIVGENPAISDANVLKVRKALTKLELLVVQDIFLTRTARYAHYVLPAAAFCEKEGSYMNSERRIQWSHKAC 462  Pyrococcus fur...
P07658       390 AAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAV 469  Escherichia co...
WP_009989018 640 VLEGKIHALYIVGEDTVMVDCGTPLTRQALEKVDFLVVQDMFITETAKLADVILPAAASLEKDGTFVNTERRIQRFYKAM 719  Sulfolobus sol...
WP_010913191 652 AVDGSFKGIYIQGEDILQSDPDTKHVAGGLAAMECVVVHDLFLNETANYAHVFLPGSTFLEKDGTFTNAERRINMVRKVL 731  Mesorhizobium ...
WP_009989210 375 LRDSNVKALFLMNYNPAFSLPNRYKVIKFLKSLELLVVMDPFMTETAKYAHYVLPTPLWAEKEGSVTNLDRTVKWRFKVV 454  Sulfolobus sol...
2IV2_X       470 EPKWDLKTDWQIISEIATRMGYP---MHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRdtSDADQgTSYLFKE 546  Escherichia coli
P06131       462 DAPGESKYDWEIFCDLAKKMGADpemFTYESAQDIFEEVRTVTPQYAGMNRERLDRPEALHWPCP--SEDHPgTAMMHIE 539  Methanobacteri...
AAL81645     463 EPLGESKPDWEILTMLANALGLRg--FN---YKRVEEITEEYFKLFPELENRSVEELKNSEGIVIp----SP---RLYTD 530  Pyrococcus fur...
P07658       470 EPKWDLKTDWQIISEIATRMGYP---MHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRdtSDADQgTSYLFKE 546  Escherichia co...
WP_009989018 720 EPIGDSKPDWEIIQMVANALGAN---WSYNHPAEIMNEIAKLGPIFAGVNYSRLEGFNSLLWPVN--EDGSD-TPLLYTN 793  Sulfolobus sol...
WP_010913191 732 EPKAR-YADWEATQELARAIGLD---WNYTHPSQIMDEIAQTTPSFANVSFELLDRVGSVQWPCNe-KAPLG-TPIMHID 805  Mesorhizobium ...
WP_009989210 455 DPPGEVRSELWIIKRIAEKLGLT---GFHDDPKLVFKEIKEVAKLYSNLTLDELMDYSVDSRYPDh-E------SSLYKD 524  Sulfolobus sol...
2IV2_X       547 KFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCrSMTGNCAALAALADEPgYAQINTEDAKRLGIEDEALV 626  Escherichia coli
P06131       540 KFAHPDGLGIFMPLEEQGPMETPDDEYPLILTTTRLLFHYHA-AMTRRAATLDREVPTG-YVEINTEDAAELGIANKEKV 617  Methanobacteri...
AAL81645     531 RFLTPGGRARFISVEQIMPWEEPNGEYPLILTTVRLITHYNTgEMTMRSPSLTKMIGEP-FVLISREDAQEYGIKEGDYV 609  Pyrococcus fur...
P07658       547 KFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCrSMTGNCAALAALADEPgYAQINTEDAKRLGIEDEALV 626  Escherichia co...
WP_009989018 794 AFATKDGKAILYPLSWK-PPELKDEVHKVTVNTGRVLEHFHVgNMTRRVEGLRRKVPET-FVEVSKELASKYSIKNGDLV 871  Sulfolobus sol...
WP_010913191 806 GFVR--GKGKFIRTEYVATDERTGPRFPLLLTTGRILSQYNVgAQTRRTDNVMWHSED--RLEIHPHDAENRGLRDGDWV 881  Mesorhizobium ...
WP_009989210 525 RFMTPSGKAKFG----LVRYNEISGDS-YILITGRVVTRYNSdELIKRVPGYRNFSSD---LLINPEDATKLNIKDGDMV 596  Sulfolobus sol...
2IV2_X       627 WVHSRK-GKIITRAQVSDRPNKGAIYMTYQWWIGA--CNELV-TENLSPITKTPEYKYCAVRV 685  Escherichia coli
P06131       618 KVKSRR-GEIEIAARVTDDIVKGIVNIPMHFRECS--ANILTnAAAIDPKSGMPEYKACAVAI 677  Methanobacterium formicicum
AAL81645     610 VVETRR-GNLTLKAKISNIQRG---VIAIPFHFEA---NVLT--NDALNKAGTPELKFSAARI 663  Pyrococcus furiosus DSM 3638
P07658       627 WVHSRK-GKIITRAQVSDRPNKGAIYMTYQWWIGA--CNELV-TENLSPITKTPEYKYCAVRV 685  Escherichia coli K-12
WP_009989018 872 LVKSKFgGEIKARAIVSDRVEGEEIFIPLYASDPSkgVNNLT-GLVIDKASGTPGYKDTPVVI 933  Sulfolobus solfataricus
WP_010913191 882 RLTSRS-GETTLRALITDRVSPGVVYTTFHHPDTQ--ANVIT-TDFSDWATNCPEYKVTAVQV 940  Mesorhizobium loti
WP_009989210 597 KVVSKC-GMAVMKAKLTNEVKVGHTFAYMHDYY----VNNVV-CDDLDDISKTPRYKITFVKI 653  Sulfolobus solfataricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap