Conserved Protein Domain Family
yir-bir-cir_Pla

?
TIGR01590: yir-bir-cir_Pla 
yir/bir/cir-family of variant antigens, Plasmodium-specific
This model represents a large paralogous family of variant antigens from several Plasmodium species (P. yoelii, P. berghei and P. chabaudi). The seed was generated from a list of ORF's in P. yoelii containing a paralagous domain as defined by an algorithm implemented at TIFR. The list was aligned and reduced to six sequences approximating the most divergent clades present in the data set. The model only hits genes previously characterized as yir, bir, or cir genes above the trusted cutoff. In between trusted and noise is one gene from P. vivax (vir25) which has been characterized as a distant relative of the yir/bir/cir family. The vir family appears to be present in 600-1000 copies per haploid genome and is preferentially located in the sub-telomeric regions of the chromosomes. The genomic data for yoelii is consistent with this observation. It is not believed that there are any orthologs of this family in P. falciparum.
Statistics
?
PSSM-Id: 130651
View PSSM: TIGR01590
Aligned: 6 rows
Threshold Bit Score: 207.343
Threshold Setting Gi: 82793571
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_728095  18 DELKNSEEYDIHGiHGIEEYCLDeesreK---KCKTELSNINATCLWLLNKNIANRiD-DLSNEQAKSVIIYIMIWLNYM 93  Plasmodium yoelii ...
XP_727762  19 DELKDSGEYDFKN-SLFKKYCPK-----G---SCNNDIDKINAGCLWLIYELFVKL-GfSAGQHVLKYDSVCIIIWLGYI 88  Plasmodium yoelii ...
CDU17386   18 DQLSRDGNYQFKSyNN-HSFCTNi--------NCETDIDKINAGCLWLFKAIFFDSySfKTYAKNNINMVEYIMIWLSYI 88  Plasmodium yoelii
XP_727816  18 DDLDKSVSLELKDhKSLKNYCPIt---gSgenECDNNLGKITAGFLWLLEQCYSISkNkKYKENNTNAFFLYMISWFSYK 94  Plasmodium yoelii ...
CDS44943   31 DELNSGEY-YFKGg-SLKRYCPKs----R---NCDNDIDKINSYCLWLFNQLYGDStDfSNNENDNIIIITFIFGWLSYK 101 Plasmodium yoelii
CDU85273   16 ivfDHNSQKYTFNgKLINN---Yc---pN---NCNNDDEKVSSAFIALVTLLNGIDdK---ENIGNDKLAEYAILWLSYI 83  Plasmodium yoelii
XP_728095  94 LNLK-NDGKINLNNFYT-IIEKNANYtnctngDNDCSNKLKgktgYNN-FKDVIVKNMDFSNINFEDISKFYDAFKLLCK 170 Plasmodium yoelii ...
XP_727762  89 ISLKpQDGINKLSDYYSkHIKDNAEY------SKHEIGNEK----YNN-YKNIIDEIQEYMDIDINDMPKFYKLLKLLCN 157 Plasmodium yoelii ...
CDU17386   89 LSLKkDNSIKNLKEFYDqYISNDKEY------TSPISGVEA----YYSsYKDLMDKKNGLMSIGIKDISKFYDAFKLLCE 158 Plasmodium yoelii
XP_727816  95 LNQIrGHDSTKINDFYTkHVINSHKY------DNFTNTAYR----FTE-LKEFIDERKDLLNINIDDLSKFYDAFKLLCN 163 Plasmodium yoelii ...
CDS44943  102 LNQKaENRITKLNEFYNkHMQNVQEY------NTSIENNTK----YKT-YIDLININKELMDIDISVMSKFYGVFKNLCK 170 Plasmodium yoelii
CDU85273   84 LNQKtQNGTTKLNDFYTnHIKNNSQY------DQYITTDSG----NKI-NKDVIEKKQDLMNMEIKDIYNFYDVFKSLCN 152 Plasmodium yoelii
XP_728095 171 MHTESNDGNIecNQYLEYVNNIVDKFKKLNDDSSISGDSSYSKVWYTLSTDYDSFK 226 Plasmodium yoelii yoelii 17XNL
XP_727762 158 MNTAYTEGKS--TEVLQHANDFVDEYGKLLNDDNNIKDSSYNKILNVLSIYYDKFG 211 Plasmodium yoelii yoelii 17XNL
CDU17386  159 ICTEIDASTSncSNYLQKAKEFAKKYDDLNENYNNTKGSPYNQVLSTLSNDYNNIK 214 Plasmodium yoelii
XP_727816 164 IHGNAAKSASg-MTLSNDATHFFNEYTELNND-SKIEGTARNKILPVLSTDYDKLK 217 Plasmodium yoelii yoelii 17XNL
CDS44943  171 MYNELSKTKIngEEYLKDVNDFVNNYNTLFND---KNSNLFKQILHAASNDYNYIK 223 Plasmodium yoelii
CDU85273  153 MYSEINETNYqcNKCLKNAGEFFEKFEKINNVYGTTEGSYYLELLSSLSTEYDKFK 208 Plasmodium yoelii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap