Conserved Protein Domain Family
A_thal_3526

?
TIGR01589: A_thal_3526 
uncharacterized plant-specific domain TIGR01589
This model represents an uncharacterized plant-specific domain 57 residues in length. It is found toward the N-terminus of most proteins that contain it. Examples include at least 10 proteins from Arabidopsis thaliana and at least one from Oryza sativa.
Statistics
?
PSSM-Id: 130650
View PSSM: TIGR01589
Aligned: 4 rows
Threshold Bit Score: 91.0345
Threshold Setting Gi: 7939549
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM15056        22 IDTIKNIIATCIRKYMSLEETVNYMQENHKISHHLTKPIWEQLQKENADFFNKYHLI 78  thale cress
BAA95752        10 IHLVQHMIETCLTFNMSKEECMEALSENANINPIITSTVWKELVKENKDFFETYEQK 66  thale cress
AAK96548        52 IELVQNLIERCLQLYMSRDEVVKTLLTRARIDPGFTTLVWQKLEEENAEFFRAYYIR 108 thale cress
TIGR:At2g01560  19 TDFVHYRVEECIQGYMSKEETASFIFDTFGVSLKFTRFVWYLLEKANPDFFRCFKTH 75  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap