Conserved Protein Domain Family
citE

?
TIGR01588: citE 
citrate lyase, beta subunit
This is a model of the beta subunit of the holoenzyme citrate lyase (EC 4.1.3.6) composed of alpha (EC 2.8.3.10), beta (EC 4.1.3.34), and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The beta subunit catalyzes the reaction (3S)-citryl-CoA = acetyl-CoA + oxaloacetate. The seed contains an experimentally characterized member from Leuconostoc mesenteroides. The model covers a wide range of Gram positive bacteria. For Gram negative bacteria, it appears that only gamma proteobacteria hit this model. The model is quite robust with queries scoring either quite well or quite poorly against the model. There are currently no hits in-between the noise cutoff and trusted cutoff. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 130649
View PSSM: TIGR01588
Aligned: 4 rows
Threshold Bit Score: 493.576
Threshold Setting Gi: 490253368
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB80854       3 RLRRSMMFVPGSKPAMIRDCTIYGADSVMFDLEDSVSIAEKDSARRLVYHALTSMDFGDTETVVRVNALDSEFGIEDLKA 82  Clostridium per...
AAL95575       6 RLRRTMMFLPGNNPSMITDAYIYGPDSVMIDLEDATSVNQKDAARFLVSEALKTIDYKTTETVVRVNGLDTPFGADDIRA 85  Fusobacterium n...
O53078         5 RLRRTMMFVPGNNPAMVKDAGIFGADSIMFDLEDAVSLAEKDSARYLVYEALQTVDYGSSELVVRINGLDTPFYKNDIKA 84  Leuconostoc mes...
WP_004151372   2 KPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTARLLVYQALQHPLYQDIETVVRINPLNTPFGLADLEA 81  Klebsiella
BAB80854      83 IVRAQPDVIRLPKTETAQDVLDMEKIIASIEEEIGLsIGKTKMMAAIESALGVLNAYEIATSSKRLMGIALGAEDFVTDM 162 Clostridium per...
AAL95575      86 VVKAGVNVVRLPKTDTPNEIIAVDKLIPEVEKEIGR-EGETLLMAAIESATGIMNVKEIALASKRLMGIALGAEDYVTNL 164 Fusobacterium n...
O53078        85 MVKAGIDVIRLPKVETAAMMHELESLITDAEKEFGRpVGTTHMMAAIESALGVVNAVEIANASDRMIGIALSAEDYTTDM 164 Leuconostoc mes...
WP_004151372  82 VVRAGVDMVRLPKTDSKEDIHELEAHVERIERECGReVGSTKLMAAIESALGVVNAVEIARASPRLAAIALAAFDYVMDM 161 Klebsiella
BAB80854     163 KTHRSPEGNELFAARSHIILASRAAKISAFDTVYSDVNNEEGFIKEATLIKQLGFDGKSLINPRQIDLLHKVFEPTEKEI 242 Clostridium per...
AAL95575     165 KTSRSKHGWELYYAREAIVLAARNAGIYCFDTVYSDVNNLDGFRQEVQFIKDLGFDGKSCIHPKQVRIVHEIYTPTQKEI 244 Fusobacterium n...
O53078       165 KTHRYPDGQELLYARNVILHAARAAGIAAFDTVFTNLNDEEGFYRETQLIHQLGFDGKSLINPRQIEMVNKVYAPTEKEI 244 Leuconostoc mes...
WP_004151372 162 GTSRG-DGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLAEANLAKNLGFNGKSLVNPRQIELLHQVYAPTRKEV 240 Klebsiella
BAB80854     243 DKAIKIIEAAKEAEKRGSGVVSLNGKMIDKPVIARAERVLMLAKASGI 290 Clostridium perfringens str. 13
AAL95575     245 EKSIRIINGAKEAEAKGSGVISVDGKMVDNPIIMRAQRVLELAKASGI 292 Fusobacterium nucleatum subsp. nucleatum ATCC 2...
O53078       245 NNAQNVIAAIEEAKQKGSGVISMNGQMVDRPVVLRAQRVMKLANANHL 292 Leuconostoc mesenteroides subsp. cremoris
WP_004151372 241 DHALEVIAAAEEAETRGLGVVSLNGKMIDGPIIDHARKVVALS-ASGI 287 Klebsiella
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap