Conserved Protein Domain Family
citF

?
TIGR01584: citF 
citrate lyase, alpha subunit
This is a model of the alpha subunit of the holoenzyme citrate lyase (EC 4.1.3.6) composed of alpha (EC 2.8.3.10), beta (EC 4.1.3.34), and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The alpha subunit catalyzes the reaction Acetyl-CoA + citrate = acetate + (3S)-citryl-CoA. The seed contains an experimentally characterized member from Lactococcus lactis subsp. lactis. The model covers both Gram positive and Gram negative bacteria. It is quite robust with queries scoring either quite well or quite poorly against the model. There are currently no hits in between the noise cutoff and trusted cutoff. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 130646
View PSSM: TIGR01584
Aligned: 4 rows
Threshold Bit Score: 861.452
Threshold Setting Gi: 31322797
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB80855  24 KGEFALEPKGNIQGRKITATFCGKNKKLSSIAESIEKTGLKDGMTISFHHHFRAGDYIIRMVMKEIANLGIKNLNLCVSS 103 Clostridium perfrin...
AAL95576  26 KGVDAIKPTKNKAGAKLRMRIQDEPKMVASIEEAIKKSGLKDGMTISFHHHMRNGDTVVNEVLDIIAKMGIKDLTLAPSS 105 Fusobacterium nucle...
P44459    15 RSVYQAVPK-----SESLSRTAKDRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSS 89  Haemophilus influen...
AAP22389  29 ESVEVKDLVIERVSAKVRQSVK-PNKLVDSLEEVVLKT-VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSS 106 Lactococcus lactis ...
BAB80855 104 LTSAH-EFLIDYIKDGTVTGIETSGIRGKLGEEISKGIMKKPVIIRSHGGRARAIEAGDTKIDVAFLGVPCSDEYGNANG 182 Clostridium perfrin...
AAL95576 106 LSSCH-GPVIDHIKSGVVTGIQSSGLREPLGDEISKGILKKPVIIRSHGGRARAVEDGELHIDVAFIAAPSCDEMGNMNG 184 Fusobacterium nucle...
P44459    90 LIDSH-FPIVEHIKNGVVTKIYSSGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANG 168 Haemophilus influen...
AAP22389 107 LTNVMnDILVEAIEKGVVTNITSSGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANG 186 Lactococcus lactis ...
BAB80855 183 IHGKSQCGSLGYAIIDSKYADKVVLITDTIMPYPNVPASISQQDVDYIVEVEEIGDPNGIASGATRFTKDPKELLIAKYA 262 Clostridium perfrin...
AAL95576 185 RTGKSACGSMGYAIVDAQYADYVIAITDNLVPFPNLPASIDQTLVDSVVVVDSIGDPKKIVSGAIRDSDNPRDLLIAKNA 264 Fusobacterium nucle...
P44459   169 FTGKSKCGSLGYARVDAEYADKVVLLTEEFVEYPHHPISIAQDQVDLIVQVEAVGDPKKIGGGATRMTTNPRELLIARKC 248 Haemophilus influen...
AAP22389 187 MDGKAPFGSLGYALMDAQYADTVVAITDSLVSYPNTPASIKQTQVDYVVKIDAVGNPDKIGAGATRFTKDPKELKIASMV 266 Lactococcus lactis ...
BAB80855 263 SAVIEASGYLKDGFSIQAGTGGASLAVARFLKEKMEEKNIKASFGLGGISKQFVDLHEEGFIGTLFDVQGFDLKAVESIG 342 Clostridium perfrin...
AAL95576 265 VDVIINSGYFKDGFVYQTGTGGASLSVTKLLKEEMIKQNIKASLGLGGITSQLVSLHEEGLMDALFDTQSFDLDAVRSIA 344 Fusobacterium nucle...
P44459   249 AEVIFASGYFKDGFSLQTGSGGAALAVTRFLEEKMRRENITADFALGGITASMVALHEAGLIKKLLDVQSFDSVAAESLA 328 Haemophilus influen...
AAP22389 267 NDVIVNSPYFKNGFSFQTGTGGAALAVTRFLRQSMIDHNVKATFGLGGITKPMVDLLEEGLVDKLMDVQDFDGGSAQSMH 346 Lactococcus lactis ...
BAB80855 343 KNNKHVEIDASLYANPHNKGCIANKLDIVILSALEVDKNFNVNVITGSDGYIRGASGGHSDTAAGAKLSMIVSPLVRGRI 422 Clostridium perfrin...
AAL95576 345 ENPKHYEISASFYANPNTPGPAVNNLTFVMLSALEIDKDFNVNVMTKSDGTINQAVGGHQDTAAGARISVILAPLMRARI 424 Fusobacterium nucle...
P44459   329 RNPNHIEVSANQYANYSSKGASVERLDMVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTAASAQVAIIVAPLVRGRI 408 Haemophilus influen...
AAP22389 347 LNKNQQEIDASWYADPANKGAMVDKLDVVILSALEIDTKFNVNVMSGSDGVIRGAIGGHQD-AGTAKLTIISAPLVRGRI 425 Lactococcus lactis ...
BAB80855 423 PTIVEKVNTVITPGESIDVIVTERGVAINdklSKNKELKERLEsNKNIPILSIEELHEKALKITGTPEPIKYEDRVVGIV 502 Clostridium perfrin...
AAL95576 425 PIIVDKVTTVCTPGEAVDVICTDYGIVVN---PRRKDLIESLT-KAGVELKTIEEMKEMAEQLTGKPDPVEFTDEIVGVV 500 Fusobacterium nucle...
P44459   409 PTVVENVITCVTPGENVDILVTDHGVAVN---PKRPDLIEALS-KTDIPLFTIEQLCERAYSITGKPKEIEFTNKPVAVV 484 Haemophilus influen...
AAP22389 426 ATVVPDVTTVITPGDSIDVLVTEIGIAIN---PKRTDLLDKLSnIPGLPVYTIEELQKIAEEKLGKPEPLEFTDKVVALI 502 Lactococcus lactis ...
BAB80855 503 EYRDGSIIDVIHKVKE 518 Clostridium perfringens str. 13
AAL95576 501 EYRDGSIIDVIKKVKE 516 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
P44459   485 RYRDGSVIDTVYQVKD 500 Haemophilus influenzae Rd KW20
AAP22389 503 EYRDGSLLDIIREVKD 518 Lactococcus lactis subsp. lactis bv. diacetylactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap