Conserved Protein Domain Family
formate-DH-gamm

?
TIGR01583: formate-DH-gamm 
formate dehydrogenase, gamma subunit
This model represents the gamma chain of the gamma proteobacteria (and Aquifex aolicus) formate dehydrogenase. This subunit is integral to the cytoplasmic membrane, consisting of 4 transmembrane helices, and receives electrons from the beta subunit. The entire E. coli formate dehydrogenase N (nitrate-inducible form) has been crystallized. The gamma subunit contains two cytochromes, heme b(P) and heme b(C) near the periplasmic and cytoplasmic sides of the membrane respectively. The electron acceptor quinone binds at the cytoplasmic heme histidine ligand. NiFe-hydrogenase and thiosulfate reductase contain homologous gamma subunits, and these can be found scoring in the noise of this model. [Energy metabolism, Anaerobic, Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 130645
View PSSM: TIGR01583
Aligned: 4 rows
Threshold Bit Score: 266.676
Threshold Setting Gi: 488940099
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44451        11 RIIRHRTPARISHWMLVICFFMTMFTGVAFFFPDFAWLTEILGTPQ-----IARAIHPFTGILMFFAFIYLALLYWDHNI 85  Haemophilus inf...
WP_032473517 123 KLNRWSRSDRALHWSMAFTFLTLAFSGLMLVYGKHFLKPYIPSELWgwiiyAAKQYHNYMGPLFFILLMFVLLKWWRKSI 202 Vibrio cholerae
WP_010880649  12 QIERFSALDRILHWTTALAFLYCFLSGIGIAYAKFHWLLTFLGGGE-----FARWLHPWAGVVFSIGAVLMILKWARDMV 86  Aquifex aeolicus
WP_002851174  89 KIYAFTLFERLFHFIAAISWVILVPTGFVMMFGEVFGGGVFVR--------VCKNLHAFATILFIISIIPMFLCWIKRML 160 Campylobacter j...
P44451        86 PEKNDIRWAKGVIEVLKGNEHAVADNGKYNLGQKMLFWTLNLAMVTLLVTGIIMwrqYFSHY-FS-------IPVLRIAI 157 Haemophilus inf...
WP_032473517 203 FNKVDVQWFMKLGGMVGKYKGTHPSAGFSNAGEKAIYWLLIVFGTFAAISGLVL---DFPIFgQT-------RRDMELSN 272 Vibrio cholerae
WP_010880649  87 ITREDIVWLTKIKAYISGRHEELPEVGKYNAGQKLYAWVVFLSAIVFFLTGILMw---FPEN-FS-------MGLVRWSV 155 Aquifex aeolicus
WP_002851174 161 PASYDIRWMMIVGGYLSKIKRPVP-AGKFNFGQKSWYYIAVFGGFLMIITGGFMyflDFNSTaIQglfgltqIELLRISA 239 Campylobacter j...
P44451       158 LLHSASAFMLFTGILVHIYMAFW-VKGSIRGIVEGWVTVRWAKKHHPRWYREEVLS 212 Haemophilus influenzae Rd KW20
WP_032473517 273 LIHMLSALILICGFIFHIYIGLFgMEGALEGMVTGKVDETWAKEHHDLWYEEVKRR 328 Vibrio cholerae
WP_010880649 156 VIHEITFIIAGAFTIIHIYMATVgVPGSIWGMIGGKVSATWAKFHHPKWYREVVKR 211 Aquifex aeolicus
WP_002851174 240 IVHNFLGIVCAVFFGVHIYMAVFaIKGSIHSMISGYKEEEEVYILHSYWYKELSNK 295 Campylobacter jejuni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap