Conserved Protein Domain Family
Mo_ABC_porter

?
TIGR01581: Mo_ABC_porter 
NifC-like ABC-type porter
This model describes a clade of ABC porter genes with relatively weak homology compared to its neighbor clades, the molybdate (TIGR02141) and sulfate (TIGR00969) porters. Neighbor-Joining, PAM-distance phylogenetic trees support the separation of the clades in this way. Included in this group is a gene designated NifC in Clostridium pasturianum. It would be reasonable to presume that NifC acts as a molybdate porter since the most common form of nitrogenase is a molybdoenzyme. Several other sequences falling within the scope of this model are annotated as molybdate porters and one, from Halobacterium, is annotated as a sulfate porter. There is presently no experimental evidence to support annotations with this degree of specificity.
Statistics
?
PSSM-Id: 130643
View PSSM: TIGR01581
Aligned: 6 rows
Threshold Bit Score: 209.561
Threshold Setting Gi: 499205622
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P95156        29 IAIRVDWPRFWALITTPSSQTALLLSVKTAAASTVLCVLLGVPMALVLARSR-GRLVRSLRPLILLPLVLPPVVGGIALL 107 Mycobacterium t...
AAM03777      54 LLFVLTPSEILSALLSEEMFYSMKLSMLTSFASTFSVMCCSIPTAYALSRFS-FPGKSLIKAILGLPMAFPELVMGLALL 132 Methanosarcina ...
P18795        53 MIRYSGGSHIIQTLYDQDNIKTIILSFVTSLIALIFTFIIGTPTAFCINFVRnKVLSKILDIFVEIPVVLPPAVAGIALL 132 Clostridium pas...
WP_010907020  36 LISQLNFSFFLLVLTDPELHFALWMSLATSILSLLLAIFIAIPSAWVMSQVR-LPLQKLIDTFLDLPMVLPPLVTGLSLL 114 Pasteurella mul...
WP_010889428  30 llTRGLTASFWPALASRAVGDALRVSLLTTGITLLLTVTLVTPVAWLLARFD-FPGKPVLETLLDLPIVLPPVVAGVGLL 108 Deinococcus rad...
WP_010903162  35 FLAHTGAADIGSQLTAPDARAAIRTSLATATAATVLATVFGVPLAYTLARAT-FPGKRLVNGLVVLPLVVPPLVGGTMLL 113 Halobacterium s...
P95156       108 YAFGRlGLIGRYLEAAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVWWRVTLPLLLPG 187 Mycobacterium t...
AAM03777     133 LLFGH-GFLGPYLEAAGIKVTFTKLGIVVAQFFVAFPYAVRVIYSTFEDINPRYEQVSRSFGYGEFETFRHVTLPMARSG 211 Methanosarcina ...
P18795       133 LAFGKnGVVGNFLSNHGINVIFTSTAVIIAQFFVSSALYVRVLRDSVKSVPIELFEVSYVLGAGKIETIIKIMIPMLKKS 212 Clostridium pas...
WP_010907020 115 LLFNS-QGILSQFIPIISQWIFSPLGIIVAQTYIASSIMLRNARGTFSSLDSGYRLAAYNLGLSPLQTLLKIELPMCWKP 193 Pasteurella mul...
WP_010889428 109 LTFGRgGLLGPALELAGIQLAFSTAAVVLAQLFVSAPFYLRTARAGFQAVNRDAEDAARTDGASDGQVFRLITWPLAFPF 188 Deinococcus rad...
WP_010903162 114 TVVGRfTPLGAWAAAAGVPLTNSAIGVVLAQTFVAAPFLVVAARSGFDGVDPRFEDAARSLGRGPLATFWTVSIPLARPA 193 Halobacterium s...
P95156       188 VVSGSVLAFARSLGEFGATLTFAGSRQGVTRTLPLEIYLQRVTD-PDAAVALSLLLVVVA--ALVV 250 Mycobacterium tuberculosis
AAM03777     212 LFASSVITFARCIGAFGAVLVLAGGSYMHTEVLPVTLYLNISYGnLEMAVTSGILLMGIAflAILS 277 Methanosarcina acetivorans C2A
P18795       213 IVSGLILAWIRSLGEFGATLMFAGNIIGKTRTIPLQIYTYMQDD-IKMATAFATILYIMTfvLLLL 277 Clostridium pasteurianum
WP_010907020 194 LLCGAILAWSRAIGEFGATLMLAGATRFKTETLPMAVYLNIASGdFEIAVGASLWLLFIAacLLLV 259 Pasteurella multocida
WP_010889428 189 LLEGLVLAWARALGEFGATILFAGSLQGQTRTVTLAIYAALESDlAPALVLSAVMVLVAFglLLLV 254 Deinococcus radiodurans
WP_010903162 194 ILAGIVLTFARALGEFGATMMVATT----PRTVPIRIWIAFRSDgIDAVVPLAVALLVITlfvvga 255 Halobacterium salinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap