1Q16


Conserved Protein Domain Family
narG

?
TIGR01580: narG 
Click on image for an interactive view with Cn3D
respiratory nitrate reductase, alpha subunit
The Nitrate reductase enzyme complex allows bacteria to use nitrate as an electron acceptor during anaerobic growth. The enzyme complex consists of a tetramer that has an alpha, beta and 2 gamma subunits. The alpha and beta subunits have catalytic activity and the gamma subunits attach the enzyme to the membrane and is a b-type cytochrome that receives electrons from the quinone pool and transfers them to the beta subunit. This model is specific for the alpha subunit for nitrate reductase I (narG) and nitrate reductase II (narZ) for gram positive and gram negative bacteria.A few thermophiles and archaea also match the model The seed members used to make the model include Nitrate reductases from Pseudomonas fluorescens (GP:11344601), E.coli (SP:P09152) and B.subtilis (SP:P42175). All seed members are experimentally characterized. Some unpublished nitrate reductases, that are shorter sequences, and probably fragments fall in between the noise and trusted cutoffs. Pfam models pfam00384 (Molybdopterin oxidoreductase) and pfam01568(Molydopterin dinucleotide binding domain) will also match the nitrate reductase, alpha subunit. [Energy metabolism, Anaerobic]
Statistics
?
PSSM-Id: 162434
View PSSM: TIGR01580
Aligned: 4 rows
Threshold Bit Score: 2400.06
Threshold Setting Gi: 254763315
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q16_A      2 SKFLDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRT 81   Escherichia coli ...
AAG34373    2 SHLLDQLRFFNRKQGEFSDGHGETRKESRDWENVYRSRWQYDKIVRSTHGVNCTGSCSWKIYVKNGLITWETQQTDYPRT 81   Pseudomonas fluor...
P42175      7 SPLFRRLNYFSP-IEHHSNKHSQTTREDRDWENVYRNRWQYDKVVRSTHGVNCTGSCSWNIYVKNGIVTWEGQNLNYPST 85   Bacillus subtilis...
P09152      2 SKFLDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRT 81   Escherichia coli ...
1Q16_A     82 RPDLPNHEPRGCPRGASYSWYLYSANRLKYPMMRKRLMKMWREAKALHSdPVEAWASIIEDADKAKSFKQARGRGGFVRS 161  Escherichia coli ...
AAG34373   82 RNDLPNHEPRGCPRGASYSWYIYSANRLKYPKIRKPLLKLWREARQTLP-PVEAWASIVENKAKADSYKSKRGMGGFIRS 160  Pseudomonas fluor...
P42175     86 GPDMPDFEPRGCPRGASFSWYIYSPLRVKYPYVRGVLINLWREALQTHQnPLEAWKSIVENPEKAKSYKQARGKGGFVRA 165  Bacillus subtilis...
P09152     82 RPDLPNHEPRGCPRGASYSWYLYSANRLKYPMMRKRLMKMWREAKALHSdPVEAWASIIEDADKAKSFKQARGRGGFVRS 161  Escherichia coli ...
1Q16_A    162 SWQEVNELIAASNVYTIKNYGPDRVAGFSPIPAMSMVSYASGARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPES 241  Escherichia coli ...
AAG34373  161 SWEEVNEIIAAANVYTVKEHGPDRVVGFSPIPAMSMVSYAAGSRYLSLIGGVCLSFYDWYCDLPPASPMVWGEQTDVPES 240  Pseudomonas fluor...
P42175    166 EWPEVLKLISASLLYTVMKYGPDRNVGFSPIPAMSMISHASGSRFMSLIGGPMLSFYDWYADLPPASPQIWGDQTDVPES 245  Bacillus subtilis...
P09152    162 SWQEVNELIAASNVYTIKNYGPDRVAGFSPIPAMSMVSYASGARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPES 241  Escherichia coli ...
1Q16_A    242 ADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGTDAAMALAMGHVMLREFHLD 321  Escherichia coli ...
AAG34373  241 ADWYNSNYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAITPDYSEVAKLTDLWLNPKQGTDAALAQAFNHVIFKEFHLD 320  Pseudomonas fluor...
P42175    246 SDWYNSGYIITWGSNVPLTRTPDAHFLAEARYKGAKVISISPDFAESSKFADDWLSIRQGTDGALAMAMGHVILQEFYVN 325  Bacillus subtilis...
P09152    242 ADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGTDAAMALAMGHVMLREFHLD 321  Escherichia coli ...
1Q16_A    322 NPSQYFTDYVRRYTDMPMLVMLE-----ERDGYYAAGRMLRAADLVDALGQENNPEWKTVAFNTNG-EMVAPNGSIGFRW 395  Escherichia coli ...
AAG34373  321 KPSAYFTEYAKRYTDLPVLVMLKpmlgaAPGAGYQPDRFLRASDLTDNLGQDNNPEWKTIALDAAG-ELVSPQGSIGYRW 399  Pseudomonas fluor...
P42175    326 QETERFIEYAKQYTDFPFLVTLS-----KENGVYTAGRFLHAKDIG--R-KTKHDQWKPAVWDEQTsSFAIPQGTMGSRW 397  Bacillus subtilis...
P09152    322 NPSQYFTDYVRRYTDMPMLVMLE-----ERDGYYAAGRMLRAADLVDALGQENNPEWKTVAFNTNG-EMVAPNGSIGFRW 395  Escherichia coli ...
1Q16_A    396 GEKGKWNLEQRDGKTGEETELQLSLLGSqdEIAEVGFPYFGGDGTEHFNKVELENVLLHKLPVKRLQLADGSTALVTTVY 475  Escherichia coli ...
AAG34373  400 GEKGKWNILPREGGEGREIDLKLSLIGG--DVAEVAFPYFAGEAQEYFQHVAGDAVQFRRVPVHSVVLADGSVAKVATVF 477  Pseudomonas fluor...
P42175    398 DGQQKWNLHMIDEETGEPIEPRLSVLGIedEIGTVRIPYFSND---------GNKVLERDLPIKKMNLN-GEETYITTVF 467  Bacillus subtilis...
P09152    396 GEKGKWNLEQRDGKTGEETELQLSLLGSqdEIAEVGFPYFGGDGTEHFNKVELENVLLHKLPVKRLQLADGSTALVTTVY 475  Escherichia coli ...
1Q16_A    476 DLTLANYGLERGLNDVNCATSYDDVKAY-TPAWAEQITGVSRSQIIRIAREFADNADKTHGRSMIIVGAGLNHWYHLDMN 554  Escherichia coli ...
AAG34373  478 DLSAANLAIDRGLGGANVAKDYDDASVPgTPAWQEQITGVSREKAIQIAREFADNADKTRGRSMIIVGAAMNHWYHMDMN 557  Pseudomonas fluor...
P42175    468 DLILANYGVNRGIGER-SAVSYDDPEPF-TPAWQEQMTGIKKEAVVKIAREFAQNAIDTDGRSMIIVGAGINHWFNSDTI 545  Bacillus subtilis...
P09152    476 DLTLANYGLERGLNDVNCATSYDDVKAY-TPAWAEQITGVSRSQIIRIAREFADNADKTHGRSMIIVGAGLNHWYHLDMN 554  Escherichia coli ...
1Q16_A    555 YRGLINMLIFCGCVGQSGGGWAHYVGQEKLRPQTGWQPLAFALDWQRPARHMNSTSYFYNHSSQWRYETVTAEELLSPMA 634  Escherichia coli ...
AAG34373  558 YRGLINMLMLCGCVGQTGGGWAHYVGQEKLRPQCGWLPLAFGLDWNRPPRQMNGTSFFYGHSSQWRHEKMSMHDVLSPLA 637  Pseudomonas fluor...
P42175    546 YRAVLNLVLLVGAQGVNGGGWAHYVGQEKLRPAEGWQTIATAKDWEGVPKLQNGTSFFYFATDQWRYEDQPISDLASPIA 625  Bacillus subtilis...
P09152    555 YRGLINMLIFCGCVGQSGGGWAHYVGQEKLRPQTGWQPLAFALDWQRPARHMNSTSYFYNHSSQWRYETVTAEELLSPMA 634  Escherichia coli ...
1Q16_A    635 DKSRYTGHLIDFNVRAERMGWLPSAPQLGTNPLTIAGEAEKAGMNPVD----YTVKSLKEGSIRFAAEQPENGKNHPRNL 710  Escherichia coli ...
AAG34373  638 DKSQFPEHALDYNIRAERAGWLPSAPQLNTNPLHICRDAAAAGMEPKD----YVVKSLQDGSLRFACEQPDSPVNFPRNM 713  Pseudomonas fluor...
P42175    626 ASSRY-KHHADYNVLAARLGWLPSYPTFNQNGIDLYKEAEKAGAATPEdvgaYVASQLQEKKLKFAIEDPDNEVNFPRNL 704  Bacillus subtilis...
P09152    635 DKSRYTGHLIDFNVRAERMGWLPSAPQLGTNPLTIAGEAEKAGMNPVD----YTVKSLKEGSIRFAAEQPENGKNHPRNL 710  Escherichia coli ...
1Q16_A    711 FIWRSNLLGSSGKGHEFMLKYLLGTEHGIQGKDLGQQGGVKPEEVDWQDNGLEGKLDLVVTLDFRLSSTCLYSDIILPTA 790  Escherichia coli ...
AAG34373  714 FIWRSNLLGSSGKGHEYMLKYLLGTKNGVMNEDIGHGTECKPTEAEWVDEGAIGKLDLVTTLDFRMSSTCVYSDIVLPTA 793  Pseudomonas fluor...
P42175    705 FVWRANLISSSGKGHEYFLKHLLGTTNGLMNDDS---DSIRPEEIKWREQAPEGKLDLLINLDFRMAGTALYSDIVLPAA 781  Bacillus subtilis...
P09152    711 FIWRSNLLGSSGKGHEFMLKYLLGTEHGIQGKDLGQQGGVKPEEVDWQDNGLEGKLDLVVTLDFRLSSTCLYSDIILPTA 790  Escherichia coli ...
1Q16_A    791 TWYEKDDMNTSDMHPFIHPLSAAVDPAWEAKSDWEIYKAIAKKFSEVCVG-HLGKETDIVTLPIQHDSAAELAQPLD-VK 868  Escherichia coli ...
AAG34373  794 TWYEKDDMNTSDMHPFIHPLSAAIDPAWESRSDWEIYKGIAKAFSAMSVG-HLGVEKDLVTVPLMHDSVGELAQPFG-GT 871  Pseudomonas fluor...
P42175    782 TWYEKHDLSSTDMHPFIHPFAPAISAPWESKSDWDIFKALSKAVSDLAEEvDMEPVKEVVATPLLHDTMQELAQPFGkIN 861  Bacillus subtilis...
P09152    791 TWYEKDDMNTSDMHPFIHPLSAAVDPAWEAKSDWEIYKAIAKKFSEVCVG-HLGKETDIVTLPIQHDSAAELAQPLD-VK 868  Escherichia coli ...
1Q16_A    869 DWKKGECDLIPGKTAPHIMVVERDYPATYERFTSIGPLMEKIGNGGKGIAWNTQSEMDLLRKLNYTKAEg-PAKGQPMLN 947  Escherichia coli ...
AAG34373  872 DWKSAGVAPQPGKNAPNLQVVERDYPNIYKQFTSLGPMLEKLGNGGKGINWNTDTEVKFLGELNHKEVDagISQGRPKID 951  Pseudomonas fluor...
P42175    862 DWSKGECEAIPGKTMPNIQVVERDYKHIFHKMTALGPNVALKPSGTKGMSWSIADEYESLKQRLGEITSdsVAKGCPNIS 941  Bacillus subtilis...
P09152    869 DWKKGECDLIPGKTAPHIMVVERDYPATYERFTSIGPLMEKIGNGGKGIAWNTQSEMDLLRKLNYTKAEg-PAKGQPMLN 947  Escherichia coli ...
1Q16_A    948 TAIDAAEMILTLAPETNGQVAVKAWAALSEFTGRDHTHLALNKEDEKIRFRDIQAQPRKIISSPTWSGLEDEHVSYNAGY 1027 Escherichia coli ...
AAG34373  952 SAIDAAEVILSLAPETNGHVAVKAWAALSEFTGIDHSHLAVSKEHEAIGFRDIQAQPRKFISSPTWSGLEDDNVSYNAGY 1031 Pseudomonas fluor...
P42175    942 EAKQAAEAILTLSSTSNGKVAVKAWESLENITNLKLKDLAEEREEECFTFEQITAQPKTVITSPAFTGSEKGGRRYSPFT 1021 Bacillus subtilis...
P09152    948 TAIDAAEMILTLAPETNGQVAVKAWAALSEFTGRDHTHLALNKEDEKIRFRDIQAQPRKIISSPTWSGLEDEHVSYNAGY 1027 Escherichia coli ...
1Q16_A   1028 TNVHELIPWRTLSGRQQLYQDHQWMRDFGESLLVYRPPIDTRSVKEVIGQKSNGNQEKALNFLTPHQKWGIHSTYSDNLL 1107 Escherichia coli ...
AAG34373 1032 TNVHESIPWRTITGRQQFYQDHPWMQAFGEQLMSYRPPVNTRTFAGVKGKRSNGETEIVLNWITPHQKWGIHSTYSDNLL 1111 Pseudomonas fluor...
P42175   1022 TNVEKLIPWRTLTGRQSYYVDHELMMEFGETMATFKPILQHRPFLSKRPDQEG--KEIVLNYLTPHNKWSVHSMYFDSLP 1099 Bacillus subtilis...
P09152   1028 TNVHELIPWRTLSGRQQLYQDHQWMRDFGESLLVYRPPIDTRSVKEVIGQKSNGNQEKALNFLTPHQKWGIHSTYSDNLL 1107 Escherichia coli ...
1Q16_A   1108 MLTLGRGGPVVWLSEADAKDLGIADNDWIEVFNSNGALTARAVVSQRVPAGMTMMYHAQERIVNLPGSEITQQRGGIHNS 1187 Escherichia coli ...
AAG34373 1112 MLTLSRGGQIVWLSEIDAKRAGIEDNDWIECFNVNGALTARAVVSQRVKEGMVMMYHAQERIVNVPGSETTKTRGGHHNS 1191 Pseudomonas fluor...
P42175   1100 MLTLFRGGPTVWMNKDDAEDTDIKDNDWIECFNRNGVVVARAVLSHRIPKGMAFMHHAQDRHINVPGTKLTNNRGGTHNS 1179 Bacillus subtilis...
P09152   1108 MLTLGRGGPVVWLSEADAKDLGIADNDWIEVFNSNGALTARAVVSQRVPAGMTMMYHAQERIVNLPGSEITQQRGGIHNS 1187 Escherichia coli ...
1Q16_A   1188 VTRITPKPTHMIGGYAHLAYGFNYYGTVGSNRDEFVVVRKMKNIDWLD 1235 Escherichia coli K-12
AAG34373 1192 VTRVVLKPTHMIGGYAQQAYGFNYYGTVGCNRDEFVVVRKMVKVDWLD 1239 Pseudomonas fluorescens
P42175   1180 PTRIHVKPTQMIGGYAQLSYGFNYYGPTGNQRDLNVVIRKLKEVDWLE 1227 Bacillus subtilis subsp. subtilis str. 168
P09152   1188 VTRITPKPTHMIGGYAHLAYGFNYYGTVGSNRDEFVVVRKMKNIDWLD 1235 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap