Conserved Protein Domain Family
ZF_HD_prot_N

?
TIGR01566: ZF_HD_prot_N 
ZF-HD homeobox protein Cys/His-rich dimerization domain
This model describes a 54-residue domain found in the N-terminal region of plant proteins, the vast majority of which contain a ZF-HD class homeobox domain toward the C-terminus. The region between the two domains typically is rich in low complexity sequence. The companion ZF-HD homeobox domain is described in model TIGR01565.
Statistics
?
PSSM-Id: 130629
View PSSM: TIGR01566
Aligned: 5 rows
Threshold Bit Score: 96.0763
Threshold Setting Gi: 10177281
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB89331        55 TYKECLKNHAAGIGGHALDGCGEFMPsPSfNSNDPASLTCAACGCHRNFHRREE 108 thale cress
TIGR:At2g18350  81 RYRECQKNHAASSGGHVVDGCGEFMS-SG-EEGTVESLLCAACDCHRSFHRKEI 132 thale cress
AAF43944        89 KYKECLKNHAAAMGGNATDGCGEFMP-SG-EDGSIEALTCSACNCHRNFHRKEV 140 thale cress
BAB10634        63 HYYECRKNHAADIGTTAYDGCGEFVSsTG-EE---DSLNCAACGCHRNFHREEL 112 thale cress
BAB08231        36 LYNECLKNHAVSLGGHALDGCGEFTPkSTtILTDPPSLRCDACGCHRNFHRRSP 89  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap