Conserved Protein Domain Family
homeo_ZF_HD

?
TIGR01565: homeo_ZF_HD 
homeobox domain, ZF-HD class
This model represents a class of homoebox domain that differs substantially from the typical homoebox domain described in pfam00046. It is found in both C4 and C3 plants.
Statistics
?
PSSM-Id: 130628
View PSSM: TIGR01565
Aligned: 4 rows
Threshold Bit Score: 91.0835
Threshold Setting Gi: 8778211
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF79220       106 QRRRKSKFTAEQREAMKDYAAKLGWTLKDKRalREEIRVFCEGIGVTRYHFKTWVNNNKK 165 thale cress
TIGR:At2g18350 198 KKRFRTKFNEEQKEKMMEFAEKIGWRMTKLE--DDEVNRFCREIKVKRQVFKVWMHNNKQ 255 thale cress
BAB08231       147 KKHKRTKFTAEQKVKMRGFAERAGWKINGWD--EKWVREFCSEVGIERKVLKVWIHNNKY 204 thale cress
BAB10634       179 VKRLKTKFTAEQTEKMRDYAEKLRWKVRPER--QEEVEEFCVEIGVNRKNFRIWMNNHKD 236 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap